KEGG   Shewanella baltica OS185: Shew185_1113Help
Entry
Shew185_1113      CDS       T00571                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sbm  Shewanella baltica OS185
Pathway
Pentose phosphate pathway
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:sbm00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1323481..1325847)
Genome map
AA seq 788 aa AA seqDB search
MTQIHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHTDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRSFIYLVGPGHGFPAVQANLFMEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLIGDGEAETGPLAASW
YANRLVSPATSGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYFPIIVDNELEED
IYVQMTNAMDTAYAMINDIQRRARSGEDVVKPKWPVILMRTAKGWTGVSEYKGKKLEGNC
ESHQVIVNKCATDKGHLDALDNWLASYHFQELYQMNDKGELIFDADICSLIPPKQLACGR
QHLTYGGEVVRALTNPDLEKLSYGPEVPRGHRGYSMLKMGEWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSREGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVISSMADQYCKYVYASQGVHFRKPLPSCNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAYADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVLIRELLPRVKIRFVSVTELSSDGL
GSRKFKEKPWLMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETMHVSITTDMLQRLVDHRNYIKANGVDPIE
IENWIWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatacatgaaatcaatgctctgaaaaaatatgtcagagcgactaactttctt
gcgacctcgcagatttatctcaaacaaaacgtcttacataaacgtccacttgcacatact
gatatcaaaccacgtttacttggccactggggtacctgccctggcattaactttgtttat
gccaacattaaccgattgatagtgaaacataaccgctcgttcatctatttagttggtcct
ggccatggtttcccagcagtacaagctaacttattcatggaaggttcattaagtcatttc
tatccagaaacgatcccctacaatgaaacgggtatcgaagatatttgtaagaagttttcc
gccgcttatggctacccttctcatgcaaacccagaagctccaggacaaattcttgaaggt
ggcgaactaggctactcactttctgttggctggggtgcagtactcgataatccagatctg
atcgccacagtcttaattggtgacggtgaagcagaaaccggaccattagccgcgtcttgg
tacgcaaaccgtctagtctctcctgcgacaagtggtgcagtattaccgattgtgcatatc
aatggctataaaatttcaggccctacccgtatgggacgcatgagtcatgaagaactggat
cttgaattccgtggtcttggctacttccctattatcgttgataacgaattagaagaagat
atctatgtgcagatgacgaatgccatggataccgcttatgccatgatcaatgatatccaa
cgtcgtgcccgtagcggtgaagatgtggttaagcctaaatggccagtgattttaatgcgc
accgccaaaggttggacgggtgtcagtgagtataaaggtaagaaattagaaggtaactgc
gaatcacaccaagtgatcgttaataaatgtgccacagataaaggtcatctggatgcactc
gacaattggcttgccagttaccacttccaagaactttaccaaatgaatgataaaggcgag
ctgatttttgatgcagacatttgctcattaattccacctaagcaacttgcctgtggtcgt
caacatctcacctatggtggtgaagtggttagagcgttaacgaaccctgatctcgagaaa
ctcagctacggcccagaagtaccacgtggtcaccgtggttattcaatgttgaaaatgggt
gaatggatgcgtgatgcattcaagttaaaccgcgatcaacgcaatctacgtattttcagc
cctgacgaaacctattcaaatcaactacaagccgtatttgaagaaaccgatcgtgcatgg
caatggccaattgagagctgggatgaagacatgtcccgcgaaggacgagtgattgaactc
ctttctgaaaacttgctctttggtatgttgcacggctacacagtaactggccgccacggc
atgttcccaacgtatgaatcattctcacaagtgatctcatcgatggctgaccaatactgt
aaatacgtctatgcaagccaaggtgtgcatttccgtaagccgctgccttcatgtaacgtc
gtattatcttcgctgcttgaacgccaagaccataatggctactcgcatcaaaacccgtct
ttccttggggctatgctagagaagcatccaaaaattatctctgcttatttaccagcagat
gctaacagcaccttggtttataccgaacgggcttacgccgaccgcgacaaactcaatatt
cttgttgctggtaagaaagagttaccacaatggttgagcttggaagaagcgcgtaaacaa
gcaaaagatggcgtgatggtgtgggatttcgcctctgatgagaatccagatattgtgctg
gcaggttgtggtgattacgtcactcaagagtgtatggcttcattagtattgatcagagaa
ctccttccaagagtcaaaattcgcttcgttagcgtcaccgaattaagcagtgatggctta
ggaagccgcaaatttaaagaaaaaccttggttaatggacgaaatatttacccaagataaa
ggcgtggtattcaactaccatggttacccaaatacgattaaaaagttaatatttgattac
aaaggcagccgtcgcttcagaattaaaggctatgaagaagaaggttcaacaaccactcca
ttcgatatgggcgttcgtaacggcacatcacgttatcacctagtgattgatatggcttac
aaactgttccaacagggcgttattgatgaaactatgcacgtttcaatcaccacagacatg
ctacagagactagttgatcaccgcaactacattaaagcgaacggcgtagacccaatagaa
attgagaattggatatggacacgttaa

DBGET integrated database retrieval system