KEGG   Shewanella baltica OS185: Shew185_1143Help
Entry
Shew185_1143      CDS       T00571                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbm  Shewanella baltica OS185
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shew185_1143
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Shew185_1143
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Shew185_1143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1360286..1363084
Genome map
AA seq 932 aa AA seqDB search
MKKTLSASAILLALGLAACSEAPVTSSAASADKAVAQTQQAQDALTQAQLQQLGDSLVVT
YRVVTNVPDDKCLKDKADGRCFVAQIDFVPGMDLASQDWEIYLSQMRPVQSVESGELTIT
HVKGDLHRITPTAAFKGFVKGEKKQLTFRGEPWQLAETDAMPNYYLAANGLEPVIIASTQ
VGKDAETGLETRPYVEGFTNFKTQYQRSETDKLAPADAAQLFKANQSVSEDAALAVDAII
PTPQKVKIHSTDTPVSLAGGIKLEYQQDNPEQKRQVAAAVARLARLGVAESASGITVKFA
SQKGDEGSYRLDIQPTEIVIAANDAAGFSYGLSSLASLVDVNSLKVNAMTIEDSPRYSFR
GMHIDVARNFHSKQLLLDLLDQMAAYKLNKLHLHMADDEGWRLEIDGLPELTDIGSKRCH
DLDENTCLLPQLGSGPFGDTSVNGYYTKQDYIDIVKYAEARQIQVVPSMDMPGHSRAAIK
AMDARFRRLQAEDVELKNTGKVQVVPVQETANQASTAVKALDAGARQLQAEGKTTAAEQY
LLSDANDKTVYSSVQYYDDNTLNVCMESTYHFVDKVIDEIAKLHQAAGQPLTRYHIGADE
TAGAWKQSPQCLAFVANNDKGVKSIDDLGAYFIERISTMLAAKGIEAAGWSDGMSHVRPE
NMPAKVQSNIWDVIAHKGHERANQQANLGWETVLSNPEVLYFDFPYEADPKEHGYYWASR
ATNSHKVFSFMPDNLAANAEQWTDIQNQPFEADDRIKLDEAGNKVSGPREKGKPFTGLQG
QVWSESIRSDDTIEYMVFPRLLMLAERAWHQAAWEVPYQYQGAVYNQSSGAFTLTMRDAQ
AKDWQQLANTLGHKEFIKLDKAGIDYRVPTVGAEIREGKLFANIAYPGLKLEYRSLNGQW
QAYQAGQAVTAPIEVRAIAADGIRKGRSLIVN
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacactctcagcaagcgccattttactggctttaggattagcggcctgttcc
gaggcgcctgtgacgtcttccgcagcgtcagccgataaggctgtggctcaaacacagcaa
gctcaggacgcattaactcaagcgcagttacaacaactcggggattcgttagtcgtaact
taccgtgttgtgaccaatgtgccagacgataagtgcctaaaagataaagccgatggtcgc
tgttttgtcgctcaaattgatttcgtgcccggtatggatttagccagccaggattgggaa
atttatttaagccaaatgcgcccagtgcaatcggttgaaagcggtgagttgacgataacg
cacgttaaaggcgatttacatcgtattacgccaacggctgcttttaagggatttgttaag
ggcgagaaaaagcaactgacattccgtggtgagccgtggcaattggctgaaaccgacgct
atgccaaactattacctcgcagcaaacggattagaacccgtcattatcgccagcactcaa
gtgggtaaagatgccgaaacgggtttagagacgcgtccgtatgttgaagggtttacgaat
tttaaaacccaatatcaacgctctgaaacggataaactcgcgccagccgatgccgcgcaa
ttatttaaagctaatcaaagcgtgagtgaagatgccgccttagctgtggatgccattatc
ccaacgccacaaaaggtgaagatccattcaactgatacaccagtatctcttgctggtggt
attaagctcgaatatcagcaagataacccagagcaaaagcgtcaagttgcggcagcggtg
gcacgtttagctcgcctgggtgtggctgaatctgcgagtggcattacggtgaaatttgcc
agccaaaaaggggatgagggcagttatcgcttagatattcagccaactgaaattgtgatc
gctgccaatgatgcggcgggcttctcttacggtttgtcatcattagcaagccttgtggat
gtgaattcgctgaaagtgaatgccatgaccattgaagacagcccacgttattcgttccgt
ggtatgcacattgatgtggcacgtaatttccacagcaaacaattgttgctggatttgctc
gaccaaatggcggcttataagctcaataaactgcatttacacatggctgacgatgaaggt
tggcgtttagaaatcgacgggctacctgagctgactgacatcggtagtaaacgttgtcat
gatttagatgaaaatacctgcttattaccgcagttaggcagtggaccgtttggcgataca
agcgtcaatggctattacaccaaacaagactatatcgacatagtgaaatatgccgaggcg
cgtcaaattcaagtggtcccatcgatggatatgccgggtcatagccgcgccgcgattaaa
gcgatggatgcgcgttttcgtcgattacaggctgaagacgtagagcttaaaaacacgggc
aaagtgcaggttgttcctgtgcaggaaacggcaaatcaagctagcacagcggtaaaagcg
ttagatgcgggcgctcgtcaattacaagctgaagggaaaaccactgcagctgagcaatat
ttgttatccgatgcaaacgacaaaacggtttattcttcagtgcagtattacgacgacaac
acgcttaacgtgtgtatggagtcgacttatcactttgtcgataaagtgattgatgaaatt
gccaagttacaccaagccgcgggtcaaccattgacgcgttaccacattggtgccgatgaa
acggcgggagcttggaaacaatcaccccagtgtttagcatttgtcgccaataacgataaa
ggtgttaagtcgatagatgacttaggcgcttattttattgaacgaatttcgactatgtta
gcggcaaaaggcattgaagctgcggggtggagcgatggtatgagtcatgttcgtcctgag
aatatgcccgctaaagtgcagtctaatatttgggatgtgattgcccataaaggtcatgag
cgcgccaatcaacaggcgaatcttggttgggaaaccgtgctctctaatcctgaggtgctg
tactttgacttcccctatgaggccgatcccaaggagcatggctattactgggcgagccgc
gcgaccaacagccataaagtctttagctttatgccagataacttggccgccaatgccgag
caatggaccgatattcaaaatcagccgttcgaagcggacgacagaataaaacttgatgag
gcgggtaacaaagtctcgggcccaagggagaaaggcaaaccttttactggcttgcaaggg
caggtttggagtgagtcgattcgcagtgacgatacgatcgaatacatggtgttcccgcgt
ttattgatgttggctgagcgtgcttggcatcaagctgcatgggaagtgccttatcaatat
caaggcgctgtgtataaccaaagctcgggtgcttttaccttaaccatgcgtgatgcacag
gcaaaggattggcaacaactcgcgaatactttaggccacaaagagtttattaagttagat
aaagcggggattgattatcgcgtaccgacggtcggcgccgagatccgtgaaggtaaactg
tttgctaatatcgcctatcccggactcaaactggaataccgaagcctaaatggccaatgg
caagcttatcaagcggggcaggcggtcactgcaccgattgaggtccgtgcaatagctgcc
gatggtattcgtaaaggccgaagtttaatcgttaactaa

DBGET integrated database retrieval system