KEGG   Shewanella baltica OS185: Shew185_1273Help
Entry
Shew185_1273      CDS       T00571                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbm  Shewanella baltica OS185
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shew185_1273
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew185_1273
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Shew185_1273
Enzymes [BR:sbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Shew185_1273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
Position
1516007..1517290
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGQDRGLFFPTQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDELVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
SSDFDACQDLVKRAFDDPEVREGLSLNSANSINISRLLAQICYYFEAVAQSKQRHDADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLENGQWQPNQTQATMSNAMD
VSEPSNWPRVEAICEKLAWPLSNLVGMRLSEEQTSLALAELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELNLNLPLPVELEAVAHKPILSADLPADFAALKA
HLFKILT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagctttaaagaggcagtgcaa
ttaggtttaggtcaggacagaggtttgttcttccccacccaaattccggtcttagacgat
attgaagggctgctggcgttgccatttgttgagcgcagtaaaaaagtgctcggtgcatgg
cttgcctctgaactagggcaagatgcagttgatgaactggttgaacgtgcctttaacttc
gatttacctttggttgccgtcgatgagcagcgcgcttgcctcgaattgttccacggtcct
actctggcatttaaagattttggtgcgcgttttatggcgcaatgcgtcaatgcctttgtc
ggcgacacacgcttaaccattctgactgcgacttcgggtgacactggcgccgcggttgcc
gatgccttttatgggcttgaaaaagtcaatgtggtggtgctctatcctaagggtaagatc
agtgagctacaggaaaagatgttcacgacgttgggcaaaaacatccacacagttgccgta
tcgtccgattttgatgcctgccaagatctggttaaacgcgcctttgatgatccagaagtc
cgcgagggtttgagcttgaactcggcaaactctattaatatcagtcgcttactcgcgcaa
atttgttattactttgaagccgttgcccagtctaaacagcgccacgatgccgatcctgtg
atttcagtgccaagtgggaattttggtaacctgacggcgggtttattcgccaaagccatg
gggttaccggttaaacgctttatcgccgcaaccaatgcgaatgatactgtgccgcgctat
ttagaaaacggccaatggcagcccaatcaaacccaagcgactatgtctaatgcgatggat
gtgagtgagccaagtaactggccgcgagtggaagccatttgtgagaaattagcttggccg
ctgagtaacttagtgggcatgcgtttatctgaagagcaaacttcactggcattagctgag
ttgcatgcacaaggttatgtgtctgagccccatgcggcgattgcagctaaagctttgtct
ttaaccttagtgcccgatgaagtgggtatattcttaggtacagcgcatcccgctaaattt
aaggatgtggtggatagagagctaaatcttaacttaccactgccggttgaacttgaggcc
gttgcccacaaacctatcttgtcggctgacttacccgctgattttgcggcactgaaagcg
cacttattcaagatcttaacctaa

DBGET integrated database retrieval system