KEGG   Shewanella baltica OS185: Shew185_1308Help
Entry
Shew185_1308      CDS       T00571                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sbm  Shewanella baltica OS185
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sbm01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sbm00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1560666..1561991
Genome map
AA seq 441 aa AA seqDB search
MTKATTQTSRQEQIDAIKRDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKL
WELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYP
ANSVPAVVSRINNSFRRADQIQWGNGVNPEDEKFVDYFLPIIADAEAGFGGVLNAFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIART
DANAADLLTSDCDPYDRDFVTGERTNEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKP
DLEEARVFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLA
GIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTT
VIQGGHSSVTALTGSTEEEQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacgactcagacttcacgtcaagagcagattgatgcaatcaagagagat
tgggcagaaaacccacgttggaaaaacgtgcgtcgtccttacaccgcggaagaagtggtt
gcacttcgcggttcaatcgtgcctgagaatactatcgctaagcgtggtgcggctaagtta
tgggaactggttaacggcggcgctaaaaaaggctatgtgaattcgctcggtgcgttaacg
ggcggtcaagcggtacaacaggcgaaagcgggtatcgaagcgatttacctttctggttgg
caagtggctgcagatgctaacttagccggcactatgtacccagatcaatctttataccca
gcgaactcagtgccagctgtggtatcccgtatcaataactctttccgccgtgctgaccaa
attcaatggggcaatggcgttaatccagaagatgaaaaatttgttgattacttcctgccg
attattgctgatgcagaagcgggttttggcggcgtattaaatgccttcgaactgatgaag
tcgatgatcgacgcgggcgctgccggtgttcactttgaagatcagttagcttcagtgaag
aaatgtggtcacatgggcggcaaagtattagtgccaacccaagaagcggtacaaaagctg
gttgctgcacgtttagcggcggacgtgagcggtgtcgatacactggttatcgcccgtacc
gatgctaacgcggccgatttgttaacttcagattgcgacccatacgaccgtgacttcgtg
actggcgagcgtactaatgaaggtttctaccgtgttaaagcgggtcttgaccaagcgatt
tctcgcggtcttgcctatgccccgtatgcggatttgatttggtgtgaaaccgctaaaccg
gatcttgaagaagcgcgtgtttttgctgaagcgatccatgctcagtacccagatcaactg
cttgcttataactgctcgccttcgttcaactggaagaaaaatctggacgacgccactatc
gcgcgcttccaacaagccttgtcagacatgggctacaagtaccagttcatcactttagct
ggcattcacaacatgtggtacaacatgttcgacctcgcttacgactatgctcgtggcgaa
ggcatgaagcattatgttgaaaaagttcaagaagttgagtttgctgctgcgaagaaaggt
tacaccttcgttgcgcatcaacaggaagtgggcacaggttatttcgaccaagtgactacg
gttattcaaggtggccattcatcagtgaccgcactgacaggttctaccgaagaagagcag
ttttaa

DBGET integrated database retrieval system