KEGG   Shewanella baltica OS185: Shew185_1320Help
Entry
Shew185_1320      CDS       T00571                                 

Definition
4-alpha-glucanotransferase
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
sbm  Shewanella baltica OS185
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shew185_1320
Enzymes [BR:sbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Shew185_1320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1574685..1577111
Genome map
AA seq 808 aa AA seqDB search
MGLEKLLYLRGVGAEFTDCFGQEIHISEVDRQGILTCMLQEKNTVAGTAIDASATEVLSS
DAGLTNVDAVLTEALIASQIDLLDARPWTQVLPEFHWCFVDEPWISLCLPETYTSDLSVA
IECEQGESIVFDVPFSALKSIGDYRIEQTLYLHYRLDLTQLGLARLDLAEAKTQASPEHS
MPAETEAVNLASYFLSSQEFTNNPALIKNQDSFAHAADKNASDFSVLGLGFHRIALSLKH
ALETSAPAPSSALQSSVTAEADTSTLFSGTLMVAPRAAYQGVLTAVAQGKRHKPWGISVQ
LYSLRSESQWGIGDFGDLEQLIALVAAQGADFIQLNPLHALDIAAPEHPSPYSPCDRRRL
NPLYIQLQSVPEYQTLATEFSSASWLEAIALLNRDNWLDYPKVSELKYRAFEQLYRVFCE
THLANDTPRAQRFHEFVREQGTALQEFAQAEYLRSPKAFVQEEGFYLYLQFVAENQLHLC
QLKAKEVGMGLGLIRDLAVGAALQGSEVQANAEQFCLNASIGAPPDPFAPQGQNWGLTPL
DPVKLKQHNFSHFIALIRANMESCGALRIDHVMGLLRLWWWPLDKQLGHGAYVYYPVETM
LAIVCLESQRARCVVIGEDLGLVPPDIIHRLYTSGIYSNELFYFCKDHQGFKSPDQYKSQ
SLMMLANHDVPTLVAWWCGSDLHLRRQLSLFDSDEQLGEALAGREHEKQQLISLLVAQGL
LAEVMIAELDIQTLLTAWMTLGARGNSALYSVQLCDLLADRHAVNIPGTWLEYPNWQRRL
PLSLTQVSASPEILQRLQNIAAARQLPS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atggggctggaaaagttgctgtatttgcggggggttggagcagaatttactgattgtttt
ggccaagagatccatatttccgaggtagacaggcaaggtatcttgacctgtatgttacag
gaaaaaaacactgtggcagggactgccattgatgcttctgctacagaggtgttatcgagt
gatgctgggctgactaacgtcgatgcggtattgaccgaagcgctgatcgcctcacaaatt
gacttgctggatgcccgtccttggactcaggtgttacccgaattccattggtgttttgtg
gatgaaccttggataagcctttgtttacccgaaacctatacttcagatctgagtgtggca
attgaatgcgaacagggtgagtctatcgtatttgatgtgccgttctcggcgcttaagtcg
attggcgattaccgtattgaacaaacgctttatctacattatcgccttgatcttacgcaa
ctgggattagcacgcctcgatttagctgaggccaagacccaagcttcccctgaacattca
atgcccgctgagactgaggcggtgaatttagcgtcttatttcctgagcagccaagagttc
actaacaacccagccttaatcaaaaaccaagactcatttgcgcatgcagctgacaaaaat
gcgagtgatttctctgtgttaggtttgggctttcatcgtatagctttaagcttaaaacat
gctctagagaccagtgcaccagcgccaagctcagcgctacagagcagtgtgacggctgag
gctgataccagcaccttgttttctggcaccttaatggtggcaccgcgggccgcttatcaa
ggcgtactcacggctgtcgcccaaggtaagcgccataaaccttgggggatcagcgttcaa
ctctacagtttacgcagcgagagccaatggggcataggtgactttggcgatttagaacaa
ctgatcgcgctggtggcggcgcagggcgcggatttcattcaactcaatcccttgcatgcc
ctcgacattgcggcgccagagcatccgagtccctatagtccgtgcgatcgccgcagactt
aatcctctttatattcaattacaaagtgttcctgaataccaaacgcttgcgactgaattt
tcaagcgcttcttggttagaggccatcgccttactgaatcgtgacaattggctcgattat
cctaaggtgagtgagctcaaataccgtgcctttgagcagttatatcgcgttttttgtgaa
acccatttagcaaacgacacgcccagagcgcaaagattccatgagtttgtgcgtgagcag
ggcactgcgctgcaagagtttgctcaagcggaatacttacgtagcccaaaagcgtttgta
caagaggaaggtttctatctttacctgcaatttgtggccgaaaaccagttacacctttgc
cagctaaaagcgaaagaagtgggcatggggctgggattgatccgtgatttggccgttggc
gcagcgctgcagggcagtgaagtacaggccaatgccgagcagttttgtttgaatgccagt
atcggcgcaccgcccgatccctttgcgccccaagggcaaaattggggcttaacgcccctc
gatccggtgaagttaaaacaacataatttcagtcattttatcgccttgatccgcgccaat
atggaaagctgtggcgccttgcgtatcgatcacgtgatgggcttactgcgcctctggtgg
tggccactggataaacaacttggccacggtgcctatgtgtattatcccgttgaaaccatg
ctcgctatcgtttgccttgagagtcaacgcgcccgctgtgtggtgattggtgaagactta
gggctagtgccaccggacattattcatcgtctctacacttctggcatttactccaacgaa
ttgttttatttctgcaaagaccatcaaggctttaaatcaccggatcaatacaagtcccag
agcctgatgatgctggcgaaccacgatgtgccgaccttagtggcttggtggtgcggcagc
gatttgcacctgcgtcgacagctatccctgtttgattctgacgaacaattgggcgaggca
ctggctgggcgggagcatgaaaagcagcaactgatttcactgttagtcgctcaaggtctg
ttagccgaggtgatgatagccgaactcgatattcaaaccttgctcacggcttggatgacc
ctaggggctcgcggaaatagtgcgctgtacagcgtacaactgtgtgatttattggccgat
cgccatgcggtgaacattcccggcacttggctcgaatatcctaactggcagcgccgcttg
ccgctgagtttaacgcaagtgtcggcttcgccggagatactgcagcgattacaaaatatc
gctgcggcgagacagctgccgagctaa

DBGET integrated database retrieval system