KEGG   Shewanella baltica OS185: Shew185_1396Help
Entry
Shew185_1396      CDS       T00571                                 

Definition
(GenBank) Beta-N-acetylhexosaminidase
  KO
K12373  hexosaminidase [EC:3.2.1.52]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00511  Other glycan degradation
sbm00520  Amino sugar and nucleotide sugar metabolism
sbm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Shew185_1396
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Shew185_1396
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Shew185_1396
Chaperones and folding catalysts [BR:sbm03110]
 Intramolecular chaperones
  Others
   Shew185_1396
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_20 CHB_HEX Glyco_hydro_20b CHB_HEX_C Glycohydro_20b2 F_actin_bind
Motif
Other DBs
NCBI-ProteinID: ABS07546
JGI: Shew1851396
Position
complement(1677657..1680398)
Genome map
AA seq 913 aa AA seqDB search
MKGLIKQRGMIKWQGIKTALVSGVMAVLPVASVLSILAMPSVQAANAVQEANHVALNQLA
DKLQLNYQLTASYLETCPAKEAQCYRSAIELTLPTQLSNDKLSSEELNHGDWQIYFSQLS
PVYFVDAGDFSIEHINGDLHKITPKASFKGFVANQVYRIEFYSKGSQITRSEFMPNFFVA
MGDKAQIIKSTQTRRDKETGLAEQDYLAPFNAEKQFLLAKNDATPFADGQYLAEQYQALA
ADKAPDISGKLIPTPLHSQSLNSAPLSLAKGYRLTAATVDFKGRQAAFDYLDSLGFSAKD
KGTPLLLQLDTQAPKVASTEAHDSEIKNSEAYRLTITAEQISIRASSEAGLFYGLQSLAG
LISLSDDQLVAIDIQDQPRYAFRGLHIDLARNFHSLDFIKRIIPQLAAYKINKLHLHLAD
DEGWRLAIPGLPELTDVGAKRCFDLTEQSCLLPQLGSGIADVNPVDGYLTVAQYQEILQL
ADAHHIEVIPSLDMPGHSRAAIKSMEARYHHYLAKGDKAKAEEFLLTEFADKTQYSSIQY
YHDNTLNVCLPSTYHFIDTVIDEVKKMHQAVGIPLVHYHIGADETAGAWVESPACIAMKK
QKADELTGLHSLNGYFIERVANMLAEKGIIAAGWNDGMGEVRPENMPAQVQSNAWSQISD
NGHQIAHKQANLGWKVVISTPEVTYFDFPYASHPDERGNHWASRAIDSFKVFSFMPDNLP
VHAERWHNSLNQPFIADDSHSQLKPGHRFYGLQGHLWSEMVQSDEQAEYMLFPRMIALAE
RAWHKASWELAYDYQGKIYSQQTQHFASQLNGQAEQVLKQDWQTFAAVYANKVQPKLAKA
GVFYRIAPPGILVENQLLVLNSLYPNAELEYQLDSGPWLSYRQSFKLNDVKHIRARVKDG
ARYSRPSTWQSSL
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggactaataaaacaaagagggatgattaagtggcaggggattaagacggcctta
gtcagcggcgtcatggcagtgcttcccgtggcgtcggtgctttcaatacttgcgatgcca
tcagtacaggccgccaatgctgtgcaggaggcaaatcatgtcgcgctgaatcaattggcc
gataagctccaattaaattatcagctaaccgctagttatcttgaaacctgtcccgctaaa
gaagcccaatgctatcgctccgccattgagctaaccctgcccactcagttatccaacgac
aagttatccagcgaagagttaaatcacggcgactggcaaatttatttcagccaattatcg
cccgtttatttcgtagatgcgggtgactttagcattgagcatatcaatggcgatttacat
aaaatcactcctaaagccagctttaagggcttcgtcgccaatcaagtttatcgtattgag
ttttatagcaaaggtagccaaatcacccgttccgagtttatgccaaacttctttgtcgct
atgggcgataaggcgcagatcataaagagcactcaaacaaggcgcgataaagaaacaggt
ttagccgagcaagactacctggcgccctttaatgcagagaaacaattcttactggcaaaa
aacgatgcaaccccctttgccgatggccagtatttagcagagcaatatcaagccttagcc
gcagacaaagcacctgacattagcggcaaacttatccccacgccacttcatagccaaagc
ctaaactcggcgcctttatcccttgccaaaggttatcgactcacggctgcgactgtcgat
tttaaaggacggcaagcggcatttgattacctcgattctttaggcttttcggccaaggac
aaaggcacgccgctattattgcaactcgatactcaagctcctaaagtcgcaagcactgaa
gcccatgatagtgaaattaaaaacagcgaagcctatcggttaaccataacggctgagcaa
atcagtattcgagcgagcagtgaagcaggactcttctatggcctacaaagcctagctggg
ctgatcagtttaagtgacgatcaactggtcgccatcgatattcaagaccaacctcgctac
gcctttcgtggcctgcatatcgatttagcccgtaactttcactcgctcgattttattaaa
cgtattatcccacagctcgccgcctataaaatcaataagctgcatttgcacttagccgac
gatgaaggctggcgtttagccatccccggcttacccgaactgaccgatgtgggtgcaaaa
cgctgtttcgatttaaccgagcaaagctgtttattgccacaactgggcagtggcatagcg
gacgtaaaccccgtcgatggctacttaaccgtggcgcaataccaagaaatattacaactg
gctgatgctcaccatatcgaagtgatcccttcactggacatgccggggcattcacgcgcc
gcaataaaatccatggaggcacgttatcaccattacctcgccaagggagacaaagctaag
gcggaggagtttttactgactgaatttgcagataaaacccaatattcgtcgattcagtat
taccacgacaacacactcaatgtgtgtctgccgagtacctatcactttattgatactgtg
attgatgaagttaaaaagatgcaccaagccgtaggcattcctttagtgcattaccacata
ggcgccgatgaaaccgcaggcgcttgggtagaatcccctgcgtgtatcgcaatgaaaaaa
caaaaagccgatgagttaaccggactgcattcgctcaatggttactttatcgaacgcgtt
gctaatatgctggcggagaaagggattattgccgctggttggaatgatggtatgggtgaa
gtgcgtcccgaaaacatgccagcccaagtgcaatctaacgcttggtcgcagatttcagac
aacggccatcaaatcgcccataagcaagcaaatttgggctggaaggtcgttatctcaacg
ccagaagtcacctattttgatttcccctacgctagccatccagatgagcgcggcaatcat
tgggcctcgagggcaatagacagttttaaagtgtttagctttatgcccgataatctgcct
gtacatgccgagcgctggcacaatagcttaaatcagccatttatcgcggacgacagccac
agccagctcaaaccgggacacagattttacggcttgcaggggcatctttggagcgaaatg
gtgcaatcggatgagcaagcagaatacatgctattcccgcgcatgatagcccttgcagaa
cgggcatggcacaaggcatcgtgggaattagcctatgattatcaaggtaaaatctatagc
caacagactcaacattttgccagccaactcaatggccaagccgagcaagtccttaaacag
gattggcaaaccttcgccgcagtttacgccaataaagtgcagcctaagttagcaaaagcg
ggagttttctaccgcatagcaccacctgggattcttgttgaaaatcagctgttagtgctc
aatagcttatatcccaatgccgagctggaataccaactcgactcaggaccttggctaagc
taccgccaatcattcaagcttaatgatgtcaaacacatccgcgctagagtcaaagatggc
gcacgttactctcgcccatcgacttggcaaagctcactctaa

DBGET integrated database retrieval system