KEGG   Shewanella baltica OS185: Shew185_1396Help
Entry
Shew185_1396      CDS       T00571                                 

Definition
beta-N-acetylhexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbm  Shewanella baltica OS185
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbm00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sbm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1677657..1680398)
Genome map
AA seq 913 aa AA seqDB search
MKGLIKQRGMIKWQGIKTALVSGVMAVLPVASVLSILAMPSVQAANAVQEANHVALNQLA
DKLQLNYQLTASYLETCPAKEAQCYRSAIELTLPTQLSNDKLSSEELNHGDWQIYFSQLS
PVYFVDAGDFSIEHINGDLHKITPKASFKGFVANQVYRIEFYSKGSQITRSEFMPNFFVA
MGDKAQIIKSTQTRRDKETGLAEQDYLAPFNAEKQFLLAKNDATPFADGQYLAEQYQALA
ADKAPDISGKLIPTPLHSQSLNSAPLSLAKGYRLTAATVDFKGRQAAFDYLDSLGFSAKD
KGTPLLLQLDTQAPKVASTEAHDSEIKNSEAYRLTITAEQISIRASSEAGLFYGLQSLAG
LISLSDDQLVAIDIQDQPRYAFRGLHIDLARNFHSLDFIKRIIPQLAAYKINKLHLHLAD
DEGWRLAIPGLPELTDVGAKRCFDLTEQSCLLPQLGSGIADVNPVDGYLTVAQYQEILQL
ADAHHIEVIPSLDMPGHSRAAIKSMEARYHHYLAKGDKAKAEEFLLTEFADKTQYSSIQY
YHDNTLNVCLPSTYHFIDTVIDEVKKMHQAVGIPLVHYHIGADETAGAWVESPACIAMKK
QKADELTGLHSLNGYFIERVANMLAEKGIIAAGWNDGMGEVRPENMPAQVQSNAWSQISD
NGHQIAHKQANLGWKVVISTPEVTYFDFPYASHPDERGNHWASRAIDSFKVFSFMPDNLP
VHAERWHNSLNQPFIADDSHSQLKPGHRFYGLQGHLWSEMVQSDEQAEYMLFPRMIALAE
RAWHKASWELAYDYQGKIYSQQTQHFASQLNGQAEQVLKQDWQTFAAVYANKVQPKLAKA
GVFYRIAPPGILVENQLLVLNSLYPNAELEYQLDSGPWLSYRQSFKLNDVKHIRARVKDG
ARYSRPSTWQSSL
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggactaataaaacaaagagggatgattaagtggcaggggattaagacggcctta
gtcagcggcgtcatggcagtgcttcccgtggcgtcggtgctttcaatacttgcgatgcca
tcagtacaggccgccaatgctgtgcaggaggcaaatcatgtcgcgctgaatcaattggcc
gataagctccaattaaattatcagctaaccgctagttatcttgaaacctgtcccgctaaa
gaagcccaatgctatcgctccgccattgagctaaccctgcccactcagttatccaacgac
aagttatccagcgaagagttaaatcacggcgactggcaaatttatttcagccaattatcg
cccgtttatttcgtagatgcgggtgactttagcattgagcatatcaatggcgatttacat
aaaatcactcctaaagccagctttaagggcttcgtcgccaatcaagtttatcgtattgag
ttttatagcaaaggtagccaaatcacccgttccgagtttatgccaaacttctttgtcgct
atgggcgataaggcgcagatcataaagagcactcaaacaaggcgcgataaagaaacaggt
ttagccgagcaagactacctggcgccctttaatgcagagaaacaattcttactggcaaaa
aacgatgcaaccccctttgccgatggccagtatttagcagagcaatatcaagccttagcc
gcagacaaagcacctgacattagcggcaaacttatccccacgccacttcatagccaaagc
ctaaactcggcgcctttatcccttgccaaaggttatcgactcacggctgcgactgtcgat
tttaaaggacggcaagcggcatttgattacctcgattctttaggcttttcggccaaggac
aaaggcacgccgctattattgcaactcgatactcaagctcctaaagtcgcaagcactgaa
gcccatgatagtgaaattaaaaacagcgaagcctatcggttaaccataacggctgagcaa
atcagtattcgagcgagcagtgaagcaggactcttctatggcctacaaagcctagctggg
ctgatcagtttaagtgacgatcaactggtcgccatcgatattcaagaccaacctcgctac
gcctttcgtggcctgcatatcgatttagcccgtaactttcactcgctcgattttattaaa
cgtattatcccacagctcgccgcctataaaatcaataagctgcatttgcacttagccgac
gatgaaggctggcgtttagccatccccggcttacccgaactgaccgatgtgggtgcaaaa
cgctgtttcgatttaaccgagcaaagctgtttattgccacaactgggcagtggcatagcg
gacgtaaaccccgtcgatggctacttaaccgtggcgcaataccaagaaatattacaactg
gctgatgctcaccatatcgaagtgatcccttcactggacatgccggggcattcacgcgcc
gcaataaaatccatggaggcacgttatcaccattacctcgccaagggagacaaagctaag
gcggaggagtttttactgactgaatttgcagataaaacccaatattcgtcgattcagtat
taccacgacaacacactcaatgtgtgtctgccgagtacctatcactttattgatactgtg
attgatgaagttaaaaagatgcaccaagccgtaggcattcctttagtgcattaccacata
ggcgccgatgaaaccgcaggcgcttgggtagaatcccctgcgtgtatcgcaatgaaaaaa
caaaaagccgatgagttaaccggactgcattcgctcaatggttactttatcgaacgcgtt
gctaatatgctggcggagaaagggattattgccgctggttggaatgatggtatgggtgaa
gtgcgtcccgaaaacatgccagcccaagtgcaatctaacgcttggtcgcagatttcagac
aacggccatcaaatcgcccataagcaagcaaatttgggctggaaggtcgttatctcaacg
ccagaagtcacctattttgatttcccctacgctagccatccagatgagcgcggcaatcat
tgggcctcgagggcaatagacagttttaaagtgtttagctttatgcccgataatctgcct
gtacatgccgagcgctggcacaatagcttaaatcagccatttatcgcggacgacagccac
agccagctcaaaccgggacacagattttacggcttgcaggggcatctttggagcgaaatg
gtgcaatcggatgagcaagcagaatacatgctattcccgcgcatgatagcccttgcagaa
cgggcatggcacaaggcatcgtgggaattagcctatgattatcaaggtaaaatctatagc
caacagactcaacattttgccagccaactcaatggccaagccgagcaagtccttaaacag
gattggcaaaccttcgccgcagtttacgccaataaagtgcagcctaagttagcaaaagcg
ggagttttctaccgcatagcaccacctgggattcttgttgaaaatcagctgttagtgctc
aatagcttatatcccaatgccgagctggaataccaactcgactcaggaccttggctaagc
taccgccaatcattcaagcttaatgatgtcaaacacatccgcgctagagtcaaagatggc
gcacgttactctcgcccatcgacttggcaaagctcactctaa

DBGET integrated database retrieval system