KEGG   Shewanella baltica OS185: Shew185_1397Help
Entry
Shew185_1397      CDS       T00571                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbm  Shewanella baltica OS185
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shew185_1397
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew185_1397
   00052 Galactose metabolism
    Shew185_1397
   00500 Starch and sucrose metabolism
    Shew185_1397
   00520 Amino sugar and nucleotide sugar metabolism
    Shew185_1397
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shew185_1397
   00524 Butirosin and neomycin biosynthesis
    Shew185_1397
Enzymes [BR:sbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Shew185_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1680395..1681237)
Genome map
AA seq 280 aa AA seqDB search
MSVLCLDLGGTKLMLAQVEGKTLLDTWRYPVPADGNFEQLFDFLVTCIHSHLTPETCGIS
IGIPGMVDMQSGTLLEVLNIPALTATQLAQQLKNTFEMDVVVNNDANLFALGEAVLNRNQ
DMLGITLGTGVGAGVIFNGQLYSGKHCAAGEIGSLSYRDGIIEHYCSGQYFTTHHHMSGE
YLYQKACEGDSQALQAFAHFGEHLAHMIAQTLLVYDPKDIVLGGSVSQSFPFFIEALKQK
LQSLVYGPQLADLTISASQHHNAALIGAAQWFLQQKDLAK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctatgtttagatcttgggggaactaaactgatgttggcacaggtggaaggt
aaaaccttactcgacacttggcggtatcccgttcccgccgacggcaatttcgaacaatta
ttcgatttcctcgtgacctgtatccacagccacctcacgcctgaaacctgtggtatttcc
atcgggatacccggcatggtggatatgcaaagcggcactttactcgaagtgctcaacatc
cctgcgttgacggcaacgcagttagcccagcaacttaaaaatacctttgaaatggatgtt
gttgtgaataacgacgctaacctctttgcccttggcgaagctgtgctcaatcgcaatcaa
gacatgctcgggattaccttaggcacaggcgtgggcgctggggtgatttttaatggtcag
ttgtattcgggtaaacattgcgccgcaggagaaatcggcagtttgagttatcgcgatggc
ataattgagcactattgctcggggcaatacttcaccactcaccatcacatgagtggcgaa
tatttgtatcaaaaagcctgtgaaggagacagccaagcgctgcaagccttcgcccatttt
ggtgaacacttggcgcacatgatcgcccaaaccttactggtatacgatcccaaagatatc
gtccttggcggctcagtcagccaaagctttcccttttttattgaagcgcttaaacagaaa
ttgcaaagcttagtctatggcccccaactggcggacttgacgatttcagccagccaacat
cacaatgcggcactcattggcgccgcgcaatggtttttacaacaaaaggacttagctaag
tga

DBGET integrated database retrieval system