KEGG   Shewanella baltica OS185: Shew185_1397Help
Entry
Shew185_1397      CDS       T00571                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00010  Glycolysis / Gluconeogenesis
sbm00052  Galactose metabolism
sbm00500  Starch and sucrose metabolism
sbm00520  Amino sugar and nucleotide sugar metabolism
sbm00521  Streptomycin biosynthesis
sbm01100  Metabolic pathways
sbm01110  Biosynthesis of secondary metabolites
sbm01120  Microbial metabolism in diverse environments
sbm01130  Biosynthesis of antibiotics
sbm01200  Carbon metabolism
Module
sbm_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew185_1397
   00052 Galactose metabolism
    Shew185_1397
   00500 Starch and sucrose metabolism
    Shew185_1397
   00520 Amino sugar and nucleotide sugar metabolism
    Shew185_1397
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Shew185_1397
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Shew185_1397
Enzymes [BR:sbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Shew185_1397
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ABS07547
JGI: Shew1851397
Position
complement(1680395..1681237)
Genome map
AA seq 280 aa AA seqDB search
MSVLCLDLGGTKLMLAQVEGKTLLDTWRYPVPADGNFEQLFDFLVTCIHSHLTPETCGIS
IGIPGMVDMQSGTLLEVLNIPALTATQLAQQLKNTFEMDVVVNNDANLFALGEAVLNRNQ
DMLGITLGTGVGAGVIFNGQLYSGKHCAAGEIGSLSYRDGIIEHYCSGQYFTTHHHMSGE
YLYQKACEGDSQALQAFAHFGEHLAHMIAQTLLVYDPKDIVLGGSVSQSFPFFIEALKQK
LQSLVYGPQLADLTISASQHHNAALIGAAQWFLQQKDLAK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctatgtttagatcttgggggaactaaactgatgttggcacaggtggaaggt
aaaaccttactcgacacttggcggtatcccgttcccgccgacggcaatttcgaacaatta
ttcgatttcctcgtgacctgtatccacagccacctcacgcctgaaacctgtggtatttcc
atcgggatacccggcatggtggatatgcaaagcggcactttactcgaagtgctcaacatc
cctgcgttgacggcaacgcagttagcccagcaacttaaaaatacctttgaaatggatgtt
gttgtgaataacgacgctaacctctttgcccttggcgaagctgtgctcaatcgcaatcaa
gacatgctcgggattaccttaggcacaggcgtgggcgctggggtgatttttaatggtcag
ttgtattcgggtaaacattgcgccgcaggagaaatcggcagtttgagttatcgcgatggc
ataattgagcactattgctcggggcaatacttcaccactcaccatcacatgagtggcgaa
tatttgtatcaaaaagcctgtgaaggagacagccaagcgctgcaagccttcgcccatttt
ggtgaacacttggcgcacatgatcgcccaaaccttactggtatacgatcccaaagatatc
gtccttggcggctcagtcagccaaagctttcccttttttattgaagcgcttaaacagaaa
ttgcaaagcttagtctatggcccccaactggcggacttgacgatttcagccagccaacat
cacaatgcggcactcattggcgccgcgcaatggtttttacaacaaaaggacttagctaag
tga

DBGET integrated database retrieval system