KEGG   Shewanella baltica OS185: Shew185_1451Help
Entry
Shew185_1451      CDS       T00571                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
sbm  Shewanella baltica OS185
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:sbm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1750128..1751309
Genome map
AA seq 393 aa AA seqDB search
MVILGATGSIGASTLSVISANPFAYSVYGLVANASVDKMLALCLAHKPKVAHMVDEAAAK
QLRAVLPATLNIQVTTGMNDLLGLVTAAEVDTVMAAIVGAAGLVPTLEAVKAGKRVLLAN
KEALVMSGELFIEATKRSGAVLLPVDSEHNAIFQCLPQEVQANLGRCDLAASGISHILLT
GSGGPFLRSDLATLAAMTPAQACKHPNWSMGPKISVDSATMMNKGLEFIEARWLFNTQAE
QLKVVIHPQSVIHSMVQYRDGSVIAQMGNPDMRTPIAHCMAYPQRIHSGVEPLDFFKVGQ
LSFYEPDFERFPCLALAMDACAQGQEATTVLNAANEIAVEAFLQGQIGFTQIAKVNEACL
VTVPKRPMGSIEDILALDAQTRVYARETLASIA
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggtgattttgggtgctaccggctctataggtgccagtaccttaagtgtgatctcggct
aatccattcgcttatagcgtgtatggattagtggccaacgcgagtgttgataagatgctt
gcactttgtttggcgcataaaccgaaagtggcgcatatggtggatgaagcggcagcaaaa
cagttgcgtgccgttttacctgcgacgctcaatatccaagtcaccacaggcatgaacgat
ttactcggtttagtgaccgctgccgaagtggatactgtgatggcggcgattgttggggct
gctgggctagtaccgacgcttgaagccgtaaaggcgggtaagcgggtattactggccaac
aaagaagccttagtcatgtcaggtgagctgtttattgaggcgactaagcgctctggcgct
gtgctcttgcctgtggacagtgagcataatgccatcttccaatgtctcccccaagaagtg
caagccaaccttggccgttgtgacttagcggcatcgggtatttcccatattctgttaacc
ggttctggcggacctttcctgcggtcggatcttgcgacactggccgccatgacgccagcc
caagcctgtaaacatcctaattggtccatgggacctaaaatctccgtcgactccgccact
atgatgaataagggcttagagtttattgaggcgcgttggttgtttaacactcaggctgag
caacttaaggttgttatccatccgcaaagcgtgatccactctatggtgcagtaccgtgat
ggttccgttattgcccaaatgggtaacccagatatgcgtacgcctattgcccattgcatg
gcttatccgcaaagaattcattctggcgttgaacctttagattttttcaaagtcggacag
ttaagcttttatgaacctgattttgaacgtttcccctgtttagctctggcaatggacgcg
tgtgcccaaggacaagaggcgacaactgtgttaaatgctgccaatgagattgccgttgaa
gcgtttttacagggacaaattggctttactcaaattgcaaaagtgaacgaagcttgttta
gtgacagtgcctaagcgtcctatgggcagcatagaagatattttagccttagatgcgcaa
acccgcgtctatgcgcgtgagaccttagcaagcatcgcttag

DBGET integrated database retrieval system