KEGG   Shewanella baltica OS185: Shew185_1478Help
Entry
Shew185_1478      CDS       T00571                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbm  Shewanella baltica OS185
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Shew185_1478
   00052 Galactose metabolism
    Shew185_1478
   00500 Starch and sucrose metabolism
    Shew185_1478
   00520 Amino sugar and nucleotide sugar metabolism
    Shew185_1478
Enzymes [BR:sbm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Shew185_1478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1786898..1787806)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLRRDNLAAMVALFDETQVGQIMVEGVPHNVVNQYGI
ADVNGHDLQPGESEPLVELVEKPAVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAQYLKTVVKG
MK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttccagcgaccaaagcgattccaaaggaaatgttaccggttgtcgataaaccattgatc
caatatgtggtcagtgaagctatcgctgctgggatcaaagaaattgtcctagtgacccac
gccagtaaaaactctatcgaaaaccacttcgataccagtttcgaattagaagcccaactc
gagcgccgcgttaaacgtcagttactcgaagccgtacaatctatctgtcctaaagacgtg
acagtgatcagcgtgcgtcaatctcaggcgaaaggattaggccacgccattttgtgcgca
aaatcagtagtcggcgatgcaccatttgcagtattgctgccggatgtgatcatcgatgaa
gccagctgtgatctgcgtcgcgataacttagccgctatggttgcgctgtttgatgaaacc
caagtgggtcaaatcatggttgaaggcgtgccgcacaacgtcgtcaatcagtacggtatt
gctgatgtgaatggccatgatttacaacctggtgaatctgagccattagttgaattggtt
gagaaaccagccgtggatgaagcgccatctaacttagccgttgtaggccgttatgtgtta
cctgccagcatttggccactactggctaaaacccctgcaggcgcgggcgatgaaattcaa
ttaacggatgcaattgctatgttaatgaagcaagaaaccgtgaacgcttattatatggaa
ggtaagagccacgactgtggtaacaagcaaggttacatgcgtgcgaacgttgaatatgct
ctgcgccacagcgaaatcggtgaagattttgcacaatatttaaaaaccgttgtaaaaggg
atgaagtaa

DBGET integrated database retrieval system