KEGG   Shewanella baltica OS185: Shew185_1483Help
Entry
Shew185_1483      CDS       T00571                                 

Definition
maleylacetoacetate isomerase
Orthology
K01801  
maleylpyruvate isomerase [EC:5.2.1.4]
Organism
sbm  Shewanella baltica OS185
Pathway
Tyrosine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Shew185_1483
Enzymes [BR:sbm01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.4  maleylpyruvate isomerase
     Shew185_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1792677..1793327
Genome map
AA seq 216 aa AA seqDB search
MKLYGYWRSSAAYRVRIALNLKGISAEQLSVHLVRDGGEQHKAAYSALNPLELVPTLTLD
DELDADALSQSLAIIEYLDEIHPQSPLLPASALERAHVRAMALTVACEIHPLNNLRVLQY
LTQTLGVDEAAKNTWYHHWVASGFAALETLLKRHSGRYCFGDTVTLADLCLVPQVYNAQR
FNVDLMPYPNVMRVWAECNQLEAFADAAPERQADAV
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaaactttatggttattggcgctcaagcgcggcgtaccgtgttcgcatcgccctcaat
cttaagggtatttcagccgagcagttgtctgtgcatcttgtacgtgatggcggcgagcaa
cataaagcggcctacagcgcgctgaatcctctggagttagtgccaaccttaacgttggat
gatgagctggatgcggatgctttgtcgcaatccttagccattattgaatatcttgatgag
atacacccacagtcaccattattacctgcatcggctcttgagcgtgcccatgtgcgcgcc
atggcactcacggtagcctgtgaaattcacccattaaacaatttgcgggtattgcagtat
ttaacccaaaccttaggggtcgatgaagcggctaaaaatacttggtatcaccactgggtc
gcgagtggctttgcagccttagaaactttgttgaaaaggcacagcggtcgttactgcttt
ggggatacagtgacattagccgacttgtgtttagtgccgcaggtgtataacgcccagcgt
tttaatgtggatttaatgccttatcccaatgtcatgcgcgtgtgggctgagtgtaatcag
ctagaagcctttgccgatgcggccccggagcgccaagcggatgctgtgtga

DBGET integrated database retrieval system