KEGG   Shewanella baltica OS185: Shew185_1726Help
Entry
Shew185_1726      CDS       T00571                                 

Gene name
asnB
Definition
asparagine synthetase B
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbm  Shewanella baltica OS185
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sbm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2075636..2077300)
Genome map
AA seq 554 aa AA seqDB search
MCSIFSILDIQSDAKELRQVALEMSKLMRHRGPDWSGIYASDKAILAHERLAIVDIEHGA
QPLLTEDGSLILAVNGEIYNHKELKAQLGDKYSYQTNSDCEVILALYQEYGTDFLDKLNG
IFAFVLYDKAQDRYLIGRDHMGIIPLYTGRDAAGNFYVASEMKALMPVCKTVEEFLPGQY
LYSKDGEAVKYYSRDWQSYDAVKDNPASQEELRDALEAAVKRQLMSDVPYGVLLSGGLDS
SIISAVTQTFAKRRIEDDGETNAWWPQLHSFAVGLEGAPDLIAAKKVADAIGTIHHEIHF
TFQEGLDAIKEVIYHLETYDVTTIRAATPMYLMARKIKAMGIKMVLSGEGADELFGGYLY
FHKAPNAQAFHEELVRKLDKLHLFDCLRANKAMAAWGLEARVPFLDKEFMDVAMRINPEA
KMSKDGRIEKHILRQAFEHKLPKEVAWRQKEQFSDGVGYSWIDGLKEQAAARVDDLQLAN
AKFRFPYNTPETKEAYFYRCFFEEHYPLSGAAETVPGGKSVACSTPEALAWDESLRGIID
PSGRAVRSVHTSSY
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaatcttttcgattttagatatccaatctgatgccaaagaactgcgccaagtc
gcgctagaaatgtctaagctaatgcgccaccgtggccctgactggtcaggtatttatgcc
agtgataaggcaattcttgcccacgaacgtttagccattgttgacattgaacacggtgct
cagccactgctgaccgaagatggcagtttgatccttgcggtcaacggcgaaatctataac
cacaaagaattgaaagcccagctaggcgataagtacagctatcaaaccaactctgactgt
gaagtcattctggcgctgtatcaagaatatggcactgacttccttgataaattaaacggt
atcttcgcctttgtgttatatgacaaagcccaagatagataccttatcggccgcgatcac
atgggtatcatcccgctatacacaggccgtgacgctgcgggtaacttctatgttgcctct
gaaatgaaagcgctgatgccagtgtgtaaaaccgtagaagagttcttaccgggccagtat
ctgtattcaaaagatggtgaagccgttaaatactatagccgcgattggcaaagctatgat
gcggttaaagataacccagccagccaagaagaattacgtgacgcattagaagcagcggtt
aaacgccaattgatgtcagacgtgccctatggtgtgttgctatcaggcggcttagattca
tcgatcatttccgccgtgacgcaaacctttgcgaaacgccgcattgaagacgatggcgaa
accaacgcttggtggccacagttgcattcttttgccgtcggccttgaaggtgcaccagat
ttaatcgccgccaaaaaggtcgcagatgccattggtacgattcaccatgagatccatttc
accttccaagaaggcttagatgcgattaaagaagtgatttatcacttagaaacctacgat
gtcaccaccatacgtgctgcaacgccaatgtatttaatggcgcgtaaaatcaaagccatg
ggcattaagatggtgttatcgggtgaaggtgctgacgagctatttggtggctatttatac
ttccataaagcgccaaacgcacaggcattccacgaggaattagtccgcaaactcgataag
ctgcatctgttcgattgtctgcgtgccaacaaggccatggccgcttggggattagaagcc
cgcgtgcccttcctcgataaagagtttatggatgtggcgatgcgcatcaaccctgaagcc
aaaatgtctaaggatggtcgtatcgagaaacacattctgcgccaagcctttgagcataaa
ttgccaaaagaagtggcatggcgtcaaaaggaacaattcagtgacggcgtaggctactct
tggattgacggtttgaaagaacaagctgcagcgcgggtggatgatttacaattggcaaac
gcgaaattccgtttcccatacaacacgccagaaaccaaagaagcctatttctatcgctgc
ttctttgaagaacattatccactgagcggcgctgcagaaacggtcccaggtggtaaatcc
gtcgcctgttcaacgccagaagcactggcttgggatgaaagcctacgcggcattatcgac
ccatcgggccgagcagtacgctctgtacacacctcaagttattaa

DBGET integrated database retrieval system