KEGG   Shewanella baltica OS185: Shew185_1885Help
Entry
Shew185_1885      CDS       T00571                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sbm  Shewanella baltica OS185
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Shew185_1885
Enzymes [BR:sbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Shew185_1885
Exosome [BR:sbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew185_1885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2250591..2251574)
Genome map
AA seq 327 aa AA seqDB search
MLNTPPLRRLRRLRSSEAMRDLLRETHISLSDLIHPLFIEEHITHAVPISTLPGISRLPE
SALADEVRELYALGIRYVMPFGISHTKDDKGSDTWDDNGLLARMVRTIKAAVPEMMVIPD
ICFCEYTDHGHCGVVHNNEVCNDLTVENLVKQSVTAAKAGADMLAPSAMMDGQVKAIRQG
LDAAGFEHVAILAHSAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEASLDEA
EGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAVVTETF
VGLKRAGADLIVSYYTKQYAQWLAESR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacacgcctccattgcgtcgcctaagacgcttacgtagttcagaagcgatgcgc
gatctgctgcgcgaaacccatatttcgttaagcgatctcatccatcccctgttcattgaa
gagcacatcacccacgcagtgcctatctccacgctaccaggtatcagccgtttaccagag
agtgcactggcggatgaagtgcgcgaactttacgccctcgggatccgttatgtaatgccc
tttgggatttcgcacactaaggatgataaaggcagcgacacttgggatgacaatggcttg
ctcgcccgcatggtgcgtaccattaaagccgccgtgccagagatgatggtgatccccgac
atttgtttttgtgaatacacagatcacggccattgcggcgtggtgcacaataatgaagtc
tgcaacgatctcaccgtcgaaaatttagttaagcaatcagtcactgccgctaaagcgggc
gccgacatgttagcgccatcggccatgatggacggtcaagtgaaagccattcgccaaggg
ctcgatgccgcaggttttgagcatgtggcgattctggcccactcggcaaaattcgcctct
tccttctacggtccttttagagcggcggtcgattgtgaactcagtggtaaccgcaaggga
tatcagcttgattatgccaacggtcgccaagccctgttggaagcctcattagatgaagcc
gaaggcgccgatattctgatggttaaacccggtacgccctacttagatgtgttaagccgt
ttaagacaagaaacccacttgccactcgccgcctatcaagtcggcggcgaatatgcaggc
atcaagtttgccgcccttgcaggtgcgttggatgagcgtgcagtggtgactgaaacgttt
gtcggcttaaagcgggctggagcggatttgattgtcagctattacaccaaacagtacgcc
cagtggttagccgagagtagatag

DBGET integrated database retrieval system