KEGG   Shewanella baltica OS185: Shew185_2082Help
Entry
Shew185_2082      CDS       T00571                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sbm  Shewanella baltica OS185
Brite
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Shew185_2082
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2491329..2491895
Genome map
AA seq 188 aa AA seqDB search
MNSKLKAILVAAGLSSAAITGAQLTDKWEGNSLSVYIDAVGVLTACRGHTSKDLKLDQTF
TEQQCMQIFAKDIARADKQLLQLTAPVALTDGEHAAYLSFMHWAGYGNFASSTLRKKLLV
GDRVGACKELTQACSTNPQTVERICNGWTYGTRLGVKVRLNGLIKRRAEEQTICLSELGL
SQSKGGAQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtaaactcaaggcgattttagtcgccgcaggcttaagttcggcggccatcact
ggcgcacagcttaccgataaatgggaagggaatagcctgagcgtctatatcgatgcggtg
ggcgtactgaccgcatgccgtggccatacgagcaaagacttaaagcttgatcaaaccttt
accgaacagcaatgcatgcagatttttgccaaggatatcgctcgcgctgataagcagttg
ctgcaactcacggcccctgtagcacttactgatggcgagcatgcggcctatctgtcgttt
atgcattgggcgggctatggcaattttgccagctcaaccctgcgtaaaaagctgcttgta
ggggatcgtgtgggtgcctgcaaggagctaacgcaggcctgttccaccaatcctcaaacg
gttgagcgcatctgcaatggttggacctatggcacccgcctaggtgtcaaggtgcgccta
aatgggctgattaaacgccgcgccgaagagcagaccatttgcttaagcgaactgggcctc
tcgcaatcaaaggggggcgcgcaatga

DBGET integrated database retrieval system