KEGG   Shewanella baltica OS185: Shew185_2253Help
Entry
Shew185_2253      CDS       T00571                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbm  Shewanella baltica OS185
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2683570..2684598)
Genome map
AA seq 342 aa AA seqDB search
MSSTAENKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAGTNLDLNRAIDGFLAN
SVSFTKEVNTSLYKNFIQEQSPEVIENVQIETQILINSLLSKISQLSQGTAAFSGSLAEF
GLRLQTNPDINTLNELVDGVVDEMQMLLINNREMEQSLCTMGQEVQNLKSEMENLSLAAM
TDQLTSLHNRRAYELSIQDQIYLPQDHQTRCSLLLIDIDNFKAFNDTYGHLTGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVVLPNTHFHDALQVAENLRERISERRLTIGKDKKLSL
GAITVSIGLASLQQGDDAETLFSRADKALYQAKAEGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctactgcagaaaataaagagcttgattctgccgcgcaaattttgcgtttggcc
gtaccgcaaatgtctgccctcgatatccccgttacacctgaaaactacactgtttggtat
gaatattttgcagggacaaatctcgatttaaaccgtgcgattgatggctttctggcaaat
tcggtctcttttactaaggaggtcaataccagcctgtataagaactttattcaagaacag
tcacccgaagtgattgaaaatgtgcagattgaaacgcaaatcctgatcaatagtttgtta
agtaaaatcagccagttgagtcaaggcaccgcggcgttttcaggttcattagccgagttt
ggtttacgtctacagacgaatcccgacattaataccttaaacgagctggttgatggtgta
gtcgatgaaatgcagatgctgctcatcaacaaccgtgagatggagcaaagcctgtgcacc
atgggccaagaagtgcaaaatcttaaatcggaaatggaaaacctgagcctagcagcgatg
actgaccaattaacctcgctgcacaatcgccgtgcctatgaactgagtattcaagatcaa
atctacctcccccaagatcaccaaacccgttgcagccttttgctgatcgatatcgataat
tttaaagcctttaacgacacctatggtcatttaaccggcgataaagtgttggcctatgtc
gcattagccttaaaacaatgtgtgcgaggggatgactttgtggcgcgctatggtggcgaa
gaatttgtggtggtgttacctaatactcattttcacgatgcattacaagtggctgaaaat
cttcgggaacgtatctctgagcgccgcttaaccataggaaaagacaaaaagctttccctt
ggcgcgattactgtttctattggtcttgcttcattgcagcaaggcgacgatgcagaaacc
ctcttcagtcgcgccgacaaagcgctgtatcaagcgaaggccgaaggccgtaactgcgtg
agaggataa

DBGET integrated database retrieval system