KEGG   Shewanella baltica OS185: Shew185_2474Help
Entry
Shew185_2474      CDS       T00571                                 

Definition
cupin 4 family protein
Organism
sbm  Shewanella baltica OS185
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2950577..2951716
Genome map
AA seq 379 aa AA seqDB search
MYTLNLDIAQFLSEYWQKKPLLIKKAFPQFEDPISADELAGLACEEEISSRIVVTKDNDW
EVVQGPFEDYDSYGETHWQLLVQAVNHWYPDSQPLVEALRFLPDWRFDDLMASFATPSGG
VGPHVDNYDVFIIQGEGERRWTVGDNTPQQRRGGNPNSPLVEDFTPIIDVVLEKGDMLYI
PPGFPHCGETLTVAMSYSIGFRAPSQQELVSEVADYLLDNNLGQQRFTSQTEPSSAGIVS
QDHQVGIMSLLSQLSQDPNSYQIVLGKLLSQNRFELDLCEGEEAYSIEDLQDAFAQGAGV
SRIGGLKVLRLENDATPRLFINGDVHELLNTPADVIAQLSDNVSLSADEATEICQHEEVQ
ALLLKLINQGFFYLSDSED
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactcaatctcgatatcgcccagtttcttagtgaatactggcaaaagaaaccc
ctgctgatcaaaaaagcctttccgcagtttgaagatcctatcagcgccgatgaactagca
ggccttgcctgtgaggaagaaatctcttcacgtatcgtcgtcaccaaagacaatgattgg
gaagtggtccaaggcccgtttgaggattacgacagctatggcgaaacccattggcaattg
ctagtgcaagcagtcaaccattggtatcccgattcacagccattagttgaagcgctgcgc
tttctacctgactggcgcttcgatgatttgatggcctcatttgcaaccccaagtggcggc
gtaggcccacacgtcgataactacgatgtgtttatcattcaaggcgaaggtgagcgtcgc
tggactgtgggcgacaatactccgcaacaacgccgcggtggcaacccaaactcgccgctg
gttgaagacttcaccccaattatcgatgtggtgctagaaaaaggcgacatgctttatatt
ccgccaggtttcccgcattgcggcgaaaccctaactgtggcaatgagttactcgattggt
tttcgcgccccaagccagcaagaattggtcagcgaagttgccgattatttgctcgacaat
aacttaggtcagcagcgtttcacctcacaaactgaaccgagttcagcgggtatcgtcagc
caagatcatcaagtgggcataatgtcactcttgagtcagctgagccaagatcccaatagc
taccaaatcgtgttaggtaagctactcagtcaaaaccgtttcgaacttgatttgtgtgaa
ggtgaagaagcttacagcattgaagatttgcaagatgccttcgcccaaggtgctggcgtc
agccgtatcggcggtttgaaagtattgcgccttgaaaatgatgccacgccgcgattattc
atcaatggtgacgtgcacgaattgctcaatacaccggcagacgttatcgcacagttgagc
gataacgtgagcttaagcgccgatgaagcaactgaaatctgtcagcatgaagaagttcaa
gccttactgttgaaactcatcaatcaaggtttcttttacttaagcgacagcgaagattaa

DBGET integrated database retrieval system