KEGG   Shewanella baltica OS185: Shew185_2474Help
Entry
Shew185_2474      CDS       T00571                                 

Definition
(RefSeq) cupin 4 family protein
  KO
K18850  
50S ribosomal protein L16 3-hydroxylase [EC:1.14.11.47]
Organism
sbm  Shewanella baltica OS185
Brite
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.47  50S ribosomal protein L16 3-hydroxylase
     Shew185_2474
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2950577..2951716
Genome map
AA seq 379 aa AA seqDB search
MYTLNLDIAQFLSEYWQKKPLLIKKAFPQFEDPISADELAGLACEEEISSRIVVTKDNDW
EVVQGPFEDYDSYGETHWQLLVQAVNHWYPDSQPLVEALRFLPDWRFDDLMASFATPSGG
VGPHVDNYDVFIIQGEGERRWTVGDNTPQQRRGGNPNSPLVEDFTPIIDVVLEKGDMLYI
PPGFPHCGETLTVAMSYSIGFRAPSQQELVSEVADYLLDNNLGQQRFTSQTEPSSAGIVS
QDHQVGIMSLLSQLSQDPNSYQIVLGKLLSQNRFELDLCEGEEAYSIEDLQDAFAQGAGV
SRIGGLKVLRLENDATPRLFINGDVHELLNTPADVIAQLSDNVSLSADEATEICQHEEVQ
ALLLKLINQGFFYLSDSED
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactcaatctcgatatcgcccagtttcttagtgaatactggcaaaagaaaccc
ctgctgatcaaaaaagcctttccgcagtttgaagatcctatcagcgccgatgaactagca
ggccttgcctgtgaggaagaaatctcttcacgtatcgtcgtcaccaaagacaatgattgg
gaagtggtccaaggcccgtttgaggattacgacagctatggcgaaacccattggcaattg
ctagtgcaagcagtcaaccattggtatcccgattcacagccattagttgaagcgctgcgc
tttctacctgactggcgcttcgatgatttgatggcctcatttgcaaccccaagtggcggc
gtaggcccacacgtcgataactacgatgtgtttatcattcaaggcgaaggtgagcgtcgc
tggactgtgggcgacaatactccgcaacaacgccgcggtggcaacccaaactcgccgctg
gttgaagacttcaccccaattatcgatgtggtgctagaaaaaggcgacatgctttatatt
ccgccaggtttcccgcattgcggcgaaaccctaactgtggcaatgagttactcgattggt
tttcgcgccccaagccagcaagaattggtcagcgaagttgccgattatttgctcgacaat
aacttaggtcagcagcgtttcacctcacaaactgaaccgagttcagcgggtatcgtcagc
caagatcatcaagtgggcataatgtcactcttgagtcagctgagccaagatcccaatagc
taccaaatcgtgttaggtaagctactcagtcaaaaccgtttcgaacttgatttgtgtgaa
ggtgaagaagcttacagcattgaagatttgcaagatgccttcgcccaaggtgctggcgtc
agccgtatcggcggtttgaaagtattgcgccttgaaaatgatgccacgccgcgattattc
atcaatggtgacgtgcacgaattgctcaatacaccggcagacgttatcgcacagttgagc
gataacgtgagcttaagcgccgatgaagcaactgaaatctgtcagcatgaagaagttcaa
gccttactgttgaaactcatcaatcaaggtttcttttacttaagcgacagcgaagattaa

DBGET integrated database retrieval system