KEGG   Shewanella baltica OS185: Shew185_2507Help
Entry
Shew185_2507      CDS       T00571                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
sbm  Shewanella baltica OS185
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shew185_2507
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Shew185_2507
  Amino acid metabolism
   00310 Lysine degradation
    Shew185_2507
Enzymes [BR:sbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Shew185_2507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2992918..2994108)
Genome map
AA seq 396 aa AA seqDB search
MSIEIKVPVLPESVADATIATWHVKVGEQVSRDQNLVDIETDKVVLEVVAPEDGHIGEFL
FEEGATVLGEQVIAKFIAGAVSGKEVTKAQAEAATPAAETSDESSDALSPSVRRLLAEHN
VDASKVKGTGVGGRITKEDVEAFVKSAPKAAAPAAPAVAPLAAGRSEKRVPMTRLRKTIA
NRLLEAKNSTAMLTTFNEVNMKPIMDIRKQYQDIFEKRHGIRLGFMSFYIKAVTEALKRF
PEVNASIDGDDIVYHNYFDISIAVSTPRGLVTPVLRDTDTMNLAEIEKAVRDLALKGRDG
KLTVADMTGGNFTVTNGGVFGSLMSTPILNLPQSAILGMHAIKDRPMAVNGQVEILPMMY
LALSYDHRIVDGRESVGFLVAIKDFLEDPTRLLLDL
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgagtatcgaaatcaaggtacccgtactaccagaatctgttgccgatgccacgattgcc
acttggcatgtgaaagtgggcgagcaagtttctcgtgatcaaaacctggttgatattgaa
accgataaagtggttcttgaagtggttgcgccagaagatggccacattggcgagtttttg
tttgaagaaggcgccactgttctgggtgaacaagtgatcgctaaattcatcgccggtgct
gtatctggcaaagaagtcactaaagcgcaagctgaagcggctacgcctgcagctgaaacc
agcgatgaaagcagtgatgcgttaagcccatctgtacgccgtttactggctgagcacaat
gttgatgccagcaaagtaaaaggcactggtgtgggtggtcgtattactaaagaagacgtt
gaagcttttgttaagtctgcgcctaaagctgcggcgccagcagcacctgctgtggctccg
ttagcggctggccgtagcgagaagcgcgtgccaatgacacgtctgcgtaagacaatcgct
aaccgcttgttagaagcgaaaaactctaccgctatgctcaccacgtttaacgaagtgaac
atgaagccaatcatggatatccgtaagcaataccaagatatctttgaaaagcgtcacggt
atccgtttaggctttatgtctttctacattaaagccgtgactgaagcgctgaaacgtttc
ccagaagtcaacgcgtctattgacggcgatgatatcgtttatcacaactacttcgacatc
agcatcgcagtatcaacgccacgtggtctggtaacaccagtgttacgtgacactgatacc
atgaacttagctgaaatcgaaaaagctgtccgtgacttagcccttaaaggccgtgacggt
aagctgactgtggctgacatgactggcggtaacttcactgtgactaacggtggtgttttc
ggttcattgatgtctacaccgattcttaacctgccacaaagcgcgattttaggcatgcat
gccattaaagatcgcccaatggcagtcaatggtcaggttgaaatcctgcccatgatgtac
ctggcactctcatatgaccatcgtattgttgatggccgtgagtctgttggtttcttggtg
gcgattaaagacttcctagaagacccaactcgtctgctgcttgatctgtaa

DBGET integrated database retrieval system