KEGG   Shewanella baltica OS185: Shew185_2526Help
Entry
Shew185_2526      CDS       T00571                                 

Definition
cytochrome-c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sbm  Shewanella baltica OS185
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3018519..3019553
Genome map
AA seq 344 aa AA seqDB search
MTKLTSIAIFIAGIFASAHAISAEPIEVIKAVKVTEPEKVELGKMLFFEPRLSKSGYISC
NSCHNLATGGVDALPTSVGHNWQQGPINSPTVLNANYMLAQFWDGRASDLQAQAAGPIEN
PKEMGYSHALATQTIASMPAYRAHFAKVYGDEKVTIDRLTDAISTFEKTLVTPNSPFDQY
LLGKQDAISVDAKAGYQLFKSKGCVSCHNGPAVGGTMYMKMGLIKPFHTNNPAEGRIAVT
GKEADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLSDKENLEMVAFL
VSLTGDQPQITLPILPPSNKNTPRPVPFSHDPMSSKPVSSESLK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcacatctattgctattttcattgcgggtattttcgccagtgcccatgcc
atcagtgctgaacccatcgaagtgataaaagcggtgaaagttaccgaaccggagaaagtt
gaactcggtaaaatgctgttcttcgaaccaaggctatccaaatcgggctacatctcctgt
aactcttgccacaatttggccactggcggagtcgatgccctaccaacctctgttggccat
aattggcaacaaggcccgattaactcgcccacagtgctcaatgccaattatatgctggcg
caattttgggatggccgcgccagtgatttacaagcgcaagccgctggccctatcgagaat
ccgaaggaaatgggctatagccatgcactcgcgacacaaactattgcctctatgcctgcc
tatcgggcgcattttgccaaagtctatggcgatgaaaaagtcacgattgatcgcttaacc
gatgcgatttccacctttgaaaaaactttagtcacgccaaatagtccgttcgatcaatat
ttattgggtaagcaagatgcaatcagtgtggatgccaaagcgggttaccaactgtttaag
agcaaagggtgcgtaagctgccataacggtccagccgtcggtggcactatgtatatgaag
atgggattgattaaacctttccacaccaataatcccgccgaaggccgtatcgccgtcaca
ggtaaagaagccgataagtttgtctttaaagtgccgacactgcgcaatattgaactcacc
tatccctacttccacgacggcagtgtctggaccttagaagaagcggtgaacactatggcc
gatattcaattaggccaaaaactgtcggacaaagaaaatctagaaatggtcgcctttctc
gtctcgttgacgggggatcaacctcagatcaccttgccgattttaccgccatccaacaag
aacacaccgcgcccagtgccttttagccatgatccaatgagtagcaagccagttagcagt
gagtcattaaagtag

DBGET integrated database retrieval system