KEGG   Shewanella baltica OS185: Shew185_2709Help
Entry
Shew185_2709      CDS       T00571                                 

Definition
arylesterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
sbm  Shewanella baltica OS185
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Shew185_2709
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shew185_2709
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Shew185_2709
Lipid biosynthesis proteins [BR:sbm01004]
 Fatty acid synthase
  Component type
   Shew185_2709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3244232..3244882
Genome map
AA seq 216 aa AA seqDB search
MTLDIGSFLYKSFRYQSRAKTLGAFILLSVFMATPAHAAKVLILGDSLGASYGMAEQSGW
VALLQKNLPEHQFTNGSVSGETTAGGLRRLPALLDSVAPDLVVVELGGNDGLRGFPPTQL
ENNLIQIITLAKDSGAKVLLTEIMVPPNYGPRYTQKFTQVYQDISKAQDIVLIPFFMQDI
APHPELMQRDGIHPNEKAQAQIATWMQPWIEDALTQ
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgacgttagacataggatccttcttatataaatcgttcaggtatcaatcgagagcgaag
accctgggggcattcatcctattgagtgtattcatggccacgccagcgcacgcggcaaag
gtgttgatcctcggcgacagcttaggcgctagctatggcatggcagagcagtcaggctgg
gtggcgctgctgcaaaaaaatctgcccgaacatcaatttactaatggctcagtgagcggc
gaaaccaccgcgggcggcttacgccgattacccgccttactcgattccgtcgcccccgac
cttgtggtcgttgaactgggtggtaatgatggtttacgtggattccccccaacgcaactt
gaaaataatctaatccaaatcattaccctagccaaagatagcggcgcaaaagtgctactg
accgagatcatggtaccgcctaactatggccctcgctacacccaaaagttcacccaagtg
tatcaagacatatccaaagcacaggatatcgtgttgatccccttctttatgcaggatatc
gcgccccatccagaactcatgcagcgggatggcattcaccccaacgaaaaggcccaggca
cagatagcaacttggatgcaaccatggatagaagatgcgttaacccaataa

DBGET integrated database retrieval system