KEGG   Shewanella baltica OS185: Shew185_2726Help
Entry
Shew185_2726      CDS       T00571                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbm  Shewanella baltica OS185
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shew185_2726
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew185_2726
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shew185_2726
Enzymes [BR:sbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shew185_2726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3265297..3266487
Genome map
AA seq 396 aa AA seqDB search
MSKLKLNPYFGEYGGMYVPQILVPALKQLETAFVEAQEDDDFKAEFTDLLKNYAGRPTAL
TLTRNLSPNPMVKIYLKREDLLHGGAHKTNQVLGQALLAKRMGKKEIIAETGAGQHGVAT
ALACALLGLKCKVYMGAKDVARQSPNVFRMRLMGAEVIPVTSGSATLKDACNEAMRDWSG
SYEKAHYLLGTAAGPHPFPTIVREFQRIIGEETKKQMLEREGRLPDAVIACVGGGSNAIG
MFADFIDEPSVELIGVEPAGKGIDTPMHGAPLKHGKTGIFFGMKAPLMQDSEGQIEESYS
ISAGLDFPSVGPQHAHLNATGRARYESATDDEALEAFQQLARCEGIIPALESAHAIAYAV
KMARECTKETILVVNLSGRGDKDIFTVSDILNGKEV
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaagttaaagcttaacccttatttcggcgaatacggcggcatgtatgtgccacag
attttagtgccagcccttaagcaattagaaactgcctttgtggaagcgcaggaagatgac
gactttaaagccgaatttaccgatttactgaaaaactacgcgggccgccctacagcactg
accttaacccgcaatttaagccccaaccctatggtgaaaatctacctcaaacgggaagat
ttactccacggcggcgcccataaaactaaccaagtgttaggccaagccctgcttgctaaa
cgcatgggcaaaaaggaaatcattgctgaaactggcgcaggacaacacggcgttgccacc
gcccttgcctgcgcgctattaggcttaaaatgtaaagtctatatgggtgctaaagacgtt
gcgcgccaatcaccgaacgtatttagaatgcgtttgatgggcgcggaagtcattcctgtc
acctcaggttctgccaccttaaaagatgcctgtaacgaggcgatgcgcgactggtctggc
agctacgaaaaagcccactatttactgggcacagccgcgggaccacatccgttcccgaca
atagtgcgtgaattccaacgcattattggcgaagaaaccaagaagcaaatgctggaacgc
gaaggtcgcctacctgatgcggttatcgcctgtgtgggcggcggttccaacgccatcggc
atgtttgctgactttatcgacgagccaagtgtcgaactgattggcgtcgaacctgcgggt
aaaggcatagacacgccaatgcacggcgcgccgcttaaacacggtaagacaggtattttc
ttcggtatgaaagcgcctttgatgcaagatagcgaaggccaaatcgaagaatcctattca
atttcagctggattggacttcccatccgttggcccgcagcacgcgcatcttaatgccaca
ggccgcgcccgttatgaatccgccaccgacgatgaagccttggaagccttccaacaactg
gctcgctgtgaagggattatccccgcattggaatcggcacatgctatcgcctatgccgtg
aaaatggcgcgcgagtgcaccaaagaaaccattttagtggtcaatctttccggtcgtggc
gacaaagatattttcaccgtttctgacattttaaatggtaaagaggtataa

DBGET integrated database retrieval system