KEGG   Shewanella baltica OS185: Shew185_2727Help
Entry
Shew185_2727      CDS       T00571                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbm  Shewanella baltica OS185
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Shew185_2727
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Shew185_2727
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Shew185_2727
Enzymes [BR:sbm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Shew185_2727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3266493..3267314
Genome map
AA seq 273 aa AA seqDB search
MSDTLTNTGRYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADALELGFP
FSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFANGIDA
FYAKAQQAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADSETLALVSASGEGY
TYLLSRAGVTGTDTKAGVPVEEILSKLKTFNAPPPLLGFGIAEPAQVTAAIKAGAAGAIS
GSAVVKIIETHQHDEAKLLATLGDFTRAMKAAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacactggccgttaccaagccacctttgccaaactcaaagcc
gaaggccgtggtgcttttgtccccttcgtcactcttggtgatcctagccctgagttatcg
ctgaaaattatcgataccttagtgcaaaacggtgccgatgccttagaactgggctttccg
ttttccgatcccttggccgatggccctgtgatccaaggtgctaacctgcgctctttagcc
gcgggcacaacaccaacggcgtgttttgaattactggcgcaagtgcgtgctaaatatcct
gaactgccaatcggtttgctgctgtatgcaaacttagtttttgctaatggcatagatgca
ttttacgccaaagcgcagcaagcgggtgtggattcagtgcttattgccgacgtacccgtg
gaagaatcggcgccctttagcgaagccgcaaaagcccatggtatcgcacccatttttatc
gcgccgcctaatgccgacagtgaaacccttgcactggttagcgccagcggtgaaggttac
acctatctcttatcccgcgcaggggtgacaggcacagacactaaagctggcgttccggtg
gaagaaattctatccaaattgaaaacttttaacgcgccgccaccgctactcggctttggc
attgccgaacccgctcaagtaaccgccgccatcaaagcaggcgctgcaggggcaatttct
ggctctgctgtcgtgaaaatcatcgaaacccaccagcacgatgaagctaagctactggcg
acacttggcgattttactcgcgccatgaaagcggcgacctaa

DBGET integrated database retrieval system