KEGG   Shewanella baltica OS185: Shew185_2915Help
Entry
Shew185_2915      CDS       T00571                                 

Definition
chemotaxis-specific methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sbm  Shewanella baltica OS185
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shew185_2915
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Shew185_2915
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Shew185_2915
Two-component system [BR:sbm02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Shew185_2915
Bacterial motility proteins [BR:sbm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Shew185_2915
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3497419..3498546)
Genome map
AA seq 375 aa AA seqDB search
MAIKVLVVDDSSFFRRRVSEIVNQDPELEVIATASNGAEAVKMAAELNPQVITMDIEMPV
MDGITAVREIMAKCPTPILMFSSLTHDGAKATLDALDAGALDFLPKRFEDIATNKDDAIL
LLQQRVKALGRRRMFRPIARPVVASTPSVRPTSSVLGTTSIAAHTPATAPVRTSTAASIR
ASGKQYKLLLIGTSTGGPVALQKILTQFPANYPHPILLIQHMPAAFTPAFASRLNGLCKI
EVKEAANGDLLKPGCAYLAPGGMQMMVERTGGSGRLKVIAGSADMNYKPCVDITFASASK
AFSGDVLAVVLTGMGADGREGARMLKAVGATIWAQDEASCVVYGMPQAVASAGIATQSIA
LDNMAECILKESVRV
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggccattaaagtattagtcgttgatgactcaagttttttcagacgacgtgttagtgaa
atagtcaatcaagatcctgaactggaagttatcgcgacggcctcaaatggggccgaagcg
gtgaagatggctgctgagcttaatcctcaagttatcacaatggatattgagatgcccgtg
atggatggcattactgccgtccgtgagatcatggctaaatgcccgactccgatcttgatg
ttttcttctttaacccatgatggcgctaaagcaacgttagatgctttagatgctggtgcg
ttagattttctacctaaacgttttgaagacattgctaccaataaagatgatgctatttta
ttgttgcagcagagagttaaggcattaggacgccgcagaatgtttcgtcctattgcacgt
cctgtcgtcgcttcaacacctagcgtgcgtccaacaagtagcgttttagggacaacgagt
atagcggcgcatactccagctactgctcctgtgaggacctcaactgcagcgtcgattcgt
gcaagtggtaagcagtataaattactgctgatcggcacatctaccggtggtcctgttgcc
ttgcaaaaaattcttacccaattcccggcaaactatccgcatccgattttattaatccag
catatgccagcagcttttacgccggcatttgcaagtcgtttgaatggcttatgtaagatt
gaagtgaaagaggccgctaatggtgatcttcttaaaccgggttgtgcgtatttagcgcct
ggcggtatgcaaatgatggttgaacgtactggaggcagtggtcgattaaaggttatcgct
ggcagtgcggacatgaactataagccttgtgttgatatcacctttgcttctgcctctaaa
gcctttagcggtgacgttcttgccgttgtgttaaccggtatgggcgcggatggcagagaa
ggtgcccgcatgttgaaagcggtcggtgcgaccatttgggcacaggatgaagccagttgt
gtggtttatggtatgcctcaggctgttgccagcgcgggtattgcaactcagtcgattgcc
ttagacaacatggctgaatgcattttaaaagagtctgttcgtgtctaa

DBGET integrated database retrieval system