KEGG   Shewanella baltica OS185: Shew185_3284Help
Entry
Shew185_3284      CDS       T00571                                 

Definition
(GenBank) Triose-phosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00010  Glycolysis / Gluconeogenesis
sbm00051  Fructose and mannose metabolism
sbm00562  Inositol phosphate metabolism
sbm01100  Metabolic pathways
sbm01110  Biosynthesis of secondary metabolites
sbm01120  Microbial metabolism in diverse environments
sbm01130  Biosynthesis of antibiotics
sbm01200  Carbon metabolism
sbm01230  Biosynthesis of amino acids
Module
sbm_M00002  Glycolysis, core module involving three-carbon compounds
sbm_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew185_3284
   00051 Fructose and mannose metabolism
    Shew185_3284
   00562 Inositol phosphate metabolism
    Shew185_3284
Enzymes [BR:sbm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shew185_3284
Exosome [BR:sbm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shew185_3284
  Exosomal proteins of bladder cancer cells
   Shew185_3284
  Exosomal proteins of melanoma cells
   Shew185_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABS09411
JGI: Shew1853284
UniProt: A6WRH2
Position
complement(3915112..3915894)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcccaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctgagtcaacatgactttggc
gcttataccggagaagtttcaggtcagatgctcaaagattcaggatgtcgatatgtaatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcatggcttaactcccattttatgtgtgggtgagtcaggtcca
gcacgtgaagcaagacgcacctttgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcctacgagccactttgggctgta
gggacaggtaaaagcgctacaccagagcaggcacaagaagttcatgcgtttattcgcaaa
cgcctctctgaagtatctccgtttatcggagaaaatatcaggattctctacggtggtagt
gtaacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system