KEGG   Shewanella baltica OS185: Shew185_3284Help
Entry
Shew185_3284      CDS       T00571                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbm  Shewanella baltica OS185
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Shew185_3284
   01230 Biosynthesis of amino acids
    Shew185_3284
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Shew185_3284
   00051 Fructose and mannose metabolism
    Shew185_3284
   00562 Inositol phosphate metabolism
    Shew185_3284
Enzymes [BR:sbm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Shew185_3284
Exosome [BR:sbm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Shew185_3284
  Exosomal proteins of bladder cancer cells
   Shew185_3284
  Exosomal proteins of melanoma cells
   Shew185_3284
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3915112..3915894)
Genome map
AA seq 260 aa AA seqDB search
MALRRPMVAGNWKMNGSAALAQELFKKFASKLQNDSAEVVLCPPSIYLESVRQLLEANKE
ALDGSLVRMGAQNLSQHDFGAYTGEVSGQMLKDSGCRYVIIGHSERRRMYGETSNIVAEK
FAAAQKHGLTPILCVGESGPAREARRTFEVIAEELDIVIQKNGTMAFDNAIIAYEPLWAV
GTGKSATPEQAQEVHAFIRKRLSEVSPFIGENIRILYGGSVTPSNAADLFAQPDVDGGLI
GGASLNSSEFLSLCTIAMSA
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggcactcagacgtcctatggtagctggcaattggaagatgaacggcagtgcggcatta
gcccaagagttgttcaaaaaatttgcctctaagctccaaaatgattcagctgaagtggtt
ttatgcccgccttctatctatctagagagcgttaggcaactgctagaagcaaacaaggaa
gcgttagacggttcacttgttaggatgggcgcacaaaacctgagtcaacatgactttggc
gcttataccggagaagtttcaggtcagatgctcaaagattcaggatgtcgatatgtaatt
atcgggcattcagaacgtcgccgtatgtacggagagacgagtaatatcgtagcggagaaa
ttcgccgctgcacaaaagcatggcttaactcccattttatgtgtgggtgagtcaggtcca
gcacgtgaagcaagacgcacctttgaggtgattgcggaagagttggatatagtgatccag
aaaaatggcactatggcttttgataacgccattatcgcctacgagccactttgggctgta
gggacaggtaaaagcgctacaccagagcaggcacaagaagttcatgcgtttattcgcaaa
cgcctctctgaagtatctccgtttatcggagaaaatatcaggattctctacggtggtagt
gtaacaccgagtaatgctgcagatttatttgcccaacctgatgttgatggtggactgatt
ggcggtgctagcttaaactctagcgagtttttaagtctgtgtaccatagcgatgagcgca
taa

DBGET integrated database retrieval system