KEGG   Shewanella baltica OS185: Shew185_3338Help
Entry
Shew185_3338      CDS       T00571                                 

Definition
glycoside hydrolase family protein
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
sbm  Shewanella baltica OS185
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Shew185_3338
  Lipid metabolism
   00600 Sphingolipid metabolism
    Shew185_3338
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Shew185_3338
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Shew185_3338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3973634..3975979)
Genome map
AA seq 781 aa AA seqDB search
MYFKLLFAIALLCISSVQVQASPQAQTAIKLSFNEDWQFQKSPAHATAFQPEAKAWEKVS
LPHTPKLEPLLVNDQWQGIALYQKQFNAPKSWQGQRLYLRFEGAMNHTKVWLNDKPVGEH
LGGYLPFSIDISAAVNYGADNQLRVALDNNDNPITGPKPLHLLDFNTYGGLYRDVNLFIK
APLHISDEMLTNLPNRGGLVISSKIDDKAKASVAVQADIRNQGSKAAQFTLKQVLEFDGK
VVATIAQSYTLAANSQQVFSQNLTVKQPKLWHPTHPNLYQLQTELWQGNTLLERSSNKVG
IREFAFNAKHELLINGEPYFLRGINRHQDYPHVGYATSKQADYRDAIKIKEAGFDYVRLS
HYPHSPAFMDAADEVGLVLIDAVLGWQYFSPEPEFAEHVYQSCRDLLRRDRNHASVLAWE
CSLNETPMPVAFIDNLKAIIQAELPGAMSAGWQTQYDIYLQARQHRMQHYQTPTQPYNVS
EYGDWEYYAQNAGLNQQAWADLKDDERTSRQLLGAGEKRLLQQAMNLQEAHNDNLHTPAF
ADGYWVMFDYNRGYANDLESSGIMSIYRQPKFSYYLFQSQRDPALTSTQYNAGPMVYIAS
DWQADSSPNVRVYSNADAVELWLNGKLIARQTPDNGANTDKLPHPPFTFHLPSFEAGELS
AKAFIGNQLVATHSVRTPQAIHALEISLDTAGVPINSAGSDVLFVNVRLVDANGTTVPVN
DKVVSFEVNGVIQVLNPDAIVTEKGVASALVRVHNGAKGAHLKASFAAENTAAPLTAELK
F
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtatttcaagttgttgtttgcaatagcattgctgtgtatctccagcgtgcaagtgcag
gcttcgccacaggcgcagactgccatcaaactgtcgttcaacgaagattggcaattccaa
aagtcacccgcccacgctaccgcgtttcagcctgaggctaaagcatgggaaaaagtgagc
ttaccccatacaccaaagcttgaacccctactggtcaatgaccaatggcagggtattgcc
ctgtatcaaaagcaatttaatgctcctaaatcttggcaaggacagcggctttacctgcgt
tttgaaggtgcaatgaaccacactaaagtctggttaaacgataaacctgtgggtgaacat
ttaggcggataccttccttttagcatcgatatttcagctgcggttaattacggtgcggac
aaccagttacgggtggcgttagacaataacgacaatccaattaccggtcctaaaccacta
catttactcgactttaatacctatggtggtttgtaccgcgacgttaatttattcattaaa
gcaccgctgcacatcagcgatgagatgctgacgaatttaccgaaccgtggtggtttagtg
atttcgagcaagatcgacgataaggctaaggcgagtgtggccgttcaggccgatatccgt
aatcaaggcagtaaagcggctcagttcaccttaaaacaggtgcttgagttcgacggtaaa
gtggttgcaacaatagcgcaaagctacactttggcagctaatagccagcaagttttcagc
cagaacttaacggtaaaacagccaaagttatggcatccaacccatccgaatctttatcaa
ttgcagactgaactctggcaaggcaacaccttgctcgagcgaagcagtaataaggtcggt
atccgtgaatttgcctttaatgccaagcatgaattgttgattaacggcgaaccctatttc
ctgcgcggtataaatcgtcatcaagattatccccatgtcggttatgccacctcaaaacaa
gccgattaccgtgatgccatcaagatcaaagaagccggatttgattatgttcgcttatct
cactatccccattcgcccgcctttatggacgccgccgatgaagttgggctagtgctgatt
gatgccgtattaggttggcagtatttctcacctgagcctgagtttgctgagcatgtgtat
cagtcttgcagagatctactgcgccgcgatcgtaaccacgccagcgtgttagcgtgggaa
tgctcgctcaatgaaactccaatgccagtggcctttatcgacaatctgaaagccatcatt
caggcggaacttcctggtgcaatgtctgcaggttggcaaacgcaatacgatatctatctg
caagctcgtcaacatagaatgcagcattatcaaacaccgactcagccatacaatgtgtct
gaatacggcgattgggaatactacgcccaaaatgcaggcctaaaccaacaggcgtgggcc
gatcttaaggatgatgaacgcaccagtcggcagctactcggtgctggtgaaaagcgttta
ctacaacaggcaatgaacctacaggaagcccataacgataatttgcacacgcccgcgttt
gccgacggttattgggtgatgtttgactataaccgtggctatgcgaatgacttagagtcc
tcgggcattatgagcatctatcgtcaacctaagttcagctattacctgttccaaagtcag
cgcgaccccgcgctaacgtcaacccaatacaatgccggacctatggtgtatatcgcctca
gattggcaagcggactcttcgccaaatgttcgggtgtacagtaacgcggatgccgtcgag
ttatggctaaacggcaaattaattgcccgtcaaacacccgataacggcgcgaataccgac
aagttgccccatccaccttttactttccatctgcccagttttgaggcgggagagctaagt
gctaaagcctttattggcaatcagttagtcgcgacgcacagcgttcgtactccccaagcg
attcatgcgcttgagatttcactcgataccgcaggtgtgccgattaattccgctggcagc
gatgtgctgtttgtgaatgtcagattggttgatgccaatggcaccacagtgccagtgaat
gacaaggtggtgagctttgaagtcaatggcgtgattcaagtgctcaatccggatgcgata
gtgacagaaaagggcgttgccagcgcattggtacgagtgcataacggtgcaaaaggcgcg
cacttaaaagcctcttttgcggcagaaaacacagctgcgccgttaactgctgagctgaaa
ttctaa

DBGET integrated database retrieval system