KEGG   Shewanella baltica OS185: Shew185_3523Help
Entry
Shew185_3523      CDS       T00571                                 

Definition
thiol:disulfide interchange protein DsbC
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
sbm  Shewanella baltica OS185
Brite
Enzymes [BR:sbm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Shew185_3523
Secretion system [BR:sbm02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Shew185_3523
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4188076..4188801)
Genome map
AA seq 241 aa AA seqDB search
MKLTRALSLIFALVVAPLAHAATATSPDTAAIKQKLTEMLDVEVISMQDSPIEGLYQAMT
NRGVLYISRDGSKLFHGSLYDLDKGMKNLTEAALAGPRLEMMKPLEDHMLVYKAKNEKHV
VTVFTDVSCGYCRKLHSQMADYNKLGITVRYLAFPRAGVPSANADEMQAIWCAKDPLKAM
TDAKAGSKVAAATCDAKIAEQYALGTTFGVNGTPAIVLEDGNMIPGYQPPADLLRTLEAR
Q
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaagttaacccgagcattatctttaatttttgcccttgttgtagctcctcttgctcac
gccgcaacagcgacctcgccagataccgctgctattaagcaaaaactgactgagatgttg
gatgttgaagtcatttctatgcaggattcgccgattgagggtttgtatcaagccatgacc
aaccgcggcgtgctctatattagtcgtgatggttcaaaactgttccacggcagtttgtat
gacctagataaaggcatgaaaaacttaacggaagcggcattagctggcccacgtttagaa
atgatgaagccgcttgaagaccatatgttggtttacaaagccaaaaatgaaaaacacgtg
gtcactgtatttaccgacgtcagctgtggttattgccgtaaattgcacagccaaatggcc
gattacaacaagcttggcattaccgtgcgttacttagccttcccacgtgcgggcgtgccg
tcagccaatgccgacgaaatgcaagccatctggtgtgctaaagatccattaaaagccatg
acagacgctaaagcgggcagcaaagttgccgcagcaacatgcgatgctaaaattgccgag
caatatgctttaggcaccacctttggtgtgaatggtacgccggcaatcgtgttagaagat
ggcaatatgatcccaggttatcaaccccctgcggacttattacgcaccttagaagcgcgt
cagtaa

DBGET integrated database retrieval system