KEGG   Shewanella baltica OS185: Shew185_3654Help
Entry
Shew185_3654      CDS       T00571                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sbm  Shewanella baltica OS185
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbm00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:sbm00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbm02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(4340459..4342225)
Genome map
AA seq 588 aa AA seqDB search
MNRTVTRRDFLAMSAKGVGVAVISYGLMGCSDSNDDNSVPAQFLHGIASGDPAIDAVILW
TRVTPESEGDVKVSWQVASDAAFSQLVTTGEMVTNASRDYTVKIDARGLRAGQNYFYRFM
TGDKTSVVGKTRTLPEGDVSSVKLAVMSCANFPAGYFNVYELAAAQDDLDAVVHLGDYIY
EYARGGYASEHAVELGREVLPATELLTLGDYRTRYGQYHTDASLQKLHAKVPFITVWDDH
EVANDTWRDGAENHNEGEGDFAVRKEAALQAYFEWLPIRPWREGNHEEIYRSFSYGNLVD
LHMLDTRVLARDKQLDYADYMDPTTGSFAGERFLADVTSTTRTMLGLTQLLWLQGTLLQA
TGKWQVLGQQILMGKMSLPAAIATQQMSIPQYAMLGALAKLAARAAANDPTLTAQELQYL
QANQALLTPEVIALLQLPAIPYNLDAWDGYAYEREVILGTAKSKNLNLVVIAGDTHNAWA
NELKDVNGDTVGVEFATSSVSSPGLEYYLNLPAEQIPATEAAIVELVPDLKYANLRDRGF
MTLTFTADEVRSDWHYVDTILSKDFQAATARGYSAKAKVGEHVITPIV
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtaccgtaactcgtcgtgactttttggctatgtcggccaaaggtgttggcgtt
gctgtgatctcttacggcttgatgggctgtagtgatagtaatgatgataattctgtacct
gcacaatttttacatgggattgccagtggcgatccggcgattgatgctgtgatcctttgg
acccgtgtcacgcctgagtctgagggcgatgtaaaagtgagctggcaagtggcaagcgat
gcggcctttagtcaattagtgaccacgggtgagatggtcactaatgcgagccgtgactac
acggttaagattgatgcccgcggcttacgtgctggccaaaactacttttaccgctttatg
acaggtgacaaaacctctgtcgtgggtaaaacccgtactctgcctgaaggcgatgtgagt
tctgtcaaactggcggtgatgtcctgtgcgaactttccagccggatactttaacgtatat
gaattagcggcggcgcaggatgacttagatgccgtggtgcatttaggcgattacatctat
gaatatgcccgtggcggttatgccagtgagcatgctgtagagcttggccgtgaagtctta
ccggctactgagttgctgacattgggcgattatcgcacccgttatggtcagtaccatacc
gatgcgagcctgcaaaagttacacgcgaaagtgccttttatcacggtatgggatgaccac
gaagtggccaacgatacttggcgtgatggcgccgagaatcataacgaaggcgaaggcgat
tttgctgtccgcaaagaagcggcactgcaagcttatttcgaatggttgcctattcgtcca
tggcgcgaagggaaccatgaagagatttaccgcagcttcagttacggcaatcttgtcgac
ctgcacatgctcgatacccgtgtattggcccgtgataaacagctcgattatgccgactat
atggatccgactacgggttcgtttgcgggcgagcgtttccttgccgatgtgacttcgacc
actcgcactatgctgggtctgacgcaattgttatggctgcagggcactctgctgcaagca
acgggcaagtggcaggtgttagggcaacagattttgatgggcaagatgtcattgccggcg
gcgattgcgactcagcagatgagcattccccaatatgccatgttaggcgcgttagctaag
ctagcggcgcgtgctgcggcaaatgatcccacgctgaccgcccaagagttgcaatatctt
caggctaatcaagccttattaaccccagaagttatcgcactgctgcaattacctgccatt
ccatacaacttagatgcttgggacggttacgcctacgagcgtgaggtgattttaggtacg
gctaaatcgaaaaacctcaacctagtcgtgatcgcgggcgatacccataatgcctgggct
aacgagcttaaagatgtgaatggcgataccgttggggtggagtttgcgaccagctcagtg
tcttcaccaggtcttgagtactatttgaatctgcccgctgagcagatccctgcgactgag
gcggcgatcgtcgagttagtgccagatcttaagtacgctaacttaagagatcgcggcttt
atgacgctcactttcacagctgatgaggtgcgcagcgactggcattatgtggataccatt
ctgtcgaaagatttccaagcggcaacggcacgtggttatagtgccaaggcaaaagtgggc
gagcatgtgattacccctatcgtttaa

DBGET integrated database retrieval system