KEGG   Shewanella baltica OS185: Shew185_4212Help
Entry
Shew185_4212      CDS       T00571                                 

Definition
two component transcriptional regulator
Orthology
K07660  
two-component system, OmpR family, response regulator PhoP
Organism
sbm  Shewanella baltica OS185
Pathway
Two-component system
Module
PhoQ-PhoP (magnesium transport) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shew185_4212
Two-component system [BR:sbm02022]
 OmpR family
  PhoQ-PhoP
   Shew185_4212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5022373..5023068
Genome map
AA seq 231 aa AA seqDB search
MRLLLVEDDLELQANLKQHLLDAHYSIDVASDGEEGLFQALEYNYDAAIIDVGLPKLNGI
ALIRSVREQERDFPILILTARDSWQDKVEGLDAGADDYLTKPFHPQELVARLKALIRRSA
GKASPLIYNGPFSLNTSSLEVRKGEELVNLSGSEYKLFEFFMLHQGEVKSKTVLTEHIYD
QDFDLDSNVIEVFIRRLRKKLDPDNQYNLIETLRGQGYRLKALTPEPTADE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atgcgattgttattggttgaagatgatttagaactgcaggctaacttaaaacaacatctg
ctcgatgcccattacagtatcgatgtggcgagcgatggtgaagaaggcttatttcaagca
ctcgaatacaactatgatgcggcgataatcgatgtcggtttgcctaagctcaatggtatc
gcgcttatccgcagcgtgcgcgaacaggaacgcgacttcccaatcctgattttaaccgcg
agggacagttggcaagacaaggtagaaggactcgacgccggtgccgacgactacctgacg
aaacctttccatccccaagaactggtcgcgcggctaaaagccctgatccgtcgctctgcc
ggcaaggccagccctttgatttataacggtccctttagcctaaataccagcagcttagaa
gtgcgtaaaggcgaagaactggttaacctcagcggctctgaatacaagttattcgaattt
tttatgctgcatcagggtgaagtgaaatccaaaaccgtattgacggagcacatctacgat
caggattttgatttagattctaacgtcatcgaagtctttatccgccggttacgcaaaaaa
ctcgaccctgataatcaatacaacctgattgaaaccctgcgcggccaaggttatcgccta
aaagcgttaacgcccgagccaactgccgatgagtaa

DBGET integrated database retrieval system