KEGG   Shewanella baltica OS185: Shew185_4284Help
Entry
Shew185_4284      CDS       T00571                                 

Definition
gamma-glutamyl kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sbm  Shewanella baltica OS185
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbm01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sbm00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5112058..5113158
Genome map
AA seq 366 aa AA seqDB search
MTDLPWKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRAQGIQVVLVSSGSVAAGWH
HFGEVDKPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLTHGDLRNRDRYISIKDTIF
SLLEHGLLPIINENDAVTADKLKVGDNDNLSAMVAAAADADTLIICSDVNGLYTQNPHEN
PDAQLIKQVTEINAEIYAMAGGASSAVGTGGMRTKIQAAKKAISHGIETFIINGFDADSF
NQLLKGQNPGTLFTPDEKPMQDHLHWMTHTSQAQGEVIVENDFNISLDIHSEQLTSDDVV
AINGDFSAGDTILVRKGDGTKLAKAKSNYSSCLLSFITDQDDREFASEFQQKTGPIISEK
NIAILE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttaccctggaaacgcattgtcgttaaggtaggtagtgccctgattgcaccc
cacaaacaaggttgcagcagccactacttactcggcattgcccaatttattacttattgt
cgtgcccaagggatccaagttgtcttggtctcttcgggctcagtcgccgcgggatggcat
cactttggcgaggttgataaacctagcgtcacagtgaagaaagccatggcagcagcaggt
caggccgatatgatggcgacatggaacaagttatttgatttcccgaccgcacagctactg
ttaacccacggtgatttacgcaatcgagatcgttacatcagtattaaagatacgattttc
agcctactcgaacatgggctactgcctatcatcaacgagaacgatgccgtgaccgccgac
aagctcaaagttggcgataacgataatctctcggccatggtagccgcagcggccgatgcc
gataccctgattatctgttcggatgtgaatgggctttacacacaaaacccccatgaaaat
cccgatgcacagcttatcaagcaggtgaccgagattaatgccgagatctacgccatggca
ggcggcgccagcagcgccgtcggcactggtggtatgcggactaagatacaagccgccaag
aaggcaatttcccacgggatcgaaacctttattatcaatggttttgatgctgactcattc
aaccaattgttgaagggccaaaacccaggaaccttatttacccccgatgaaaagccaatg
caagatcacttgcactggatgacacatacctcgcaggctcagggcgaagtcattgttgaa
aatgactttaatatctccctcgacatccatagcgagcaattgaccagcgacgatgtcgtt
gccatcaatggggacttttctgccggtgacaccattttagtacgcaaaggtgatggtact
aaattggccaaggccaaatccaattacagcagttgtttacttagctttattacggaccaa
gacgatcgcgagtttgccagtgaatttcagcaaaagactggaccgatcatttccgagaaa
aacatcgccattctcgaataa

DBGET integrated database retrieval system