KEGG   Shewanella baltica OS185: Shew185_4295Help
Entry
Shew185_4295      CDS       T00571                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00620  Pyruvate metabolism
sbm00630  Glyoxylate and dicarboxylate metabolism
sbm01100  Metabolic pathways
sbm01110  Biosynthesis of secondary metabolites
sbm01120  Microbial metabolism in diverse environments
sbm01200  Carbon metabolism
Module
sbm_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Shew185_4295
   00630 Glyoxylate and dicarboxylate metabolism
    Shew185_4295
Enzymes [BR:sbm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Shew185_4295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2431
Motif
Other DBs
NCBI-ProteinID: ABS10409
JGI: Shew1854295
Position
5126955..5127518
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRNGMIGA
RDVANLEDIQIETSLNMVVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtgaatgtcgccgagcacgaaaagatcgccaatgcg
aaacaattcctcgaccgcctctttccactcaactctggttcacaccaagatgtgagcagc
tatgtggtttactaccaacacctgctggctttttttgccgacggcagccacagcggttta
cgtcagccaaaacagttcgtggcttttaacggcactaaagatgcgccttgcgccatagtg
ttacaggacctaggttgccacgttgaactcagtttcgaccgcaatggcatgataggggcg
agagacgttgccaatctggaagatatccaaatcgaaacgtcattaaacatggttgtcgga
acaccagagtcacgttcagccgcatcgcgccattggctcagcctgttacatgcgggtatg
tccagcgctaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system