KEGG   Shewanella baltica OS185: Shew185_4354Help
Entry
Shew185_4354      CDS       T00571                                 

Definition
alpha/beta hydrolase fold protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sbm  Shewanella baltica OS185
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Shew185_4354
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Shew185_4354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5193417..5194400
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWKSVVQDTLITADGITLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKK
VLPKNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKAFVRWLASKL
DTTLNGGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAYRDLYDAAPKLQLGSPTNRWLTE
SLDAADSCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
AYRNQALNYALDFFKRFAIKDEDKQAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcgacagaacacgatttaaatacctcagagcagcaa
gccttctggaaaagcgttgttcaagacacgctgatcacagccgatggcatcacgctggcc
tatatgatggtcaaacatccccaagcgcataccgcaatcgttctcagtagtggccgagtt
gaatcctatttaaagtaccaagaattggtattcgacttataccagcagggttactcagtt
tatgccatcgatcaccgtggccaaggattgtcggatcgtatgacaatcaatccgcacatg
ggccatgtgcgaagatttaatgattatattgatgattttgcactgtttatgcaaaagaaa
gtgttaccaaaaaacgacaaacaactcatgctacttggccattcaatgggtggcgcgatt
ggcactttgtatctcaaacagcatcccgatatttttaccgccgcggcattttcagcgcct
atgtatggcatcaaattacctatgccaaaagcattcgtgcgctggttagccagtaagctc
gataccactctcaatggcggcgaacctaactatgtgcttggaggacagaactataaaccg
gttcccttcaaaggaaatgagctaacccattgtcaaagtagataccaagcctatcgagac
ttgtatgacgcggcccctaagttacaactcggttccccaactaaccgttggttgacagaa
tctttagatgcagcagactcctgcgtactggcaacagcgcaaattcgcacgccgatcctg
atactgcaagcgagtgaagataagattgttgataatgcggcccagaatcttgcagtgagc
actcattgccaattgaaggtgatcgcgggggctgcccatgagatttttatggaaaaagac
gcctatcggaaccaagccttaaattatgccctcgacttctttaaacgcttcgcaataaag
gacgaggacaaacaagctggataa

DBGET integrated database retrieval system