KEGG   Shewanella baltica OS195: Sbal195_0066Help
Entry
Sbal195_0066      CDS       T00622                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbn  Shewanella baltica OS195
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal195_0066
Enzymes [BR:sbn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Sbal195_0066
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(76079..77557)
Genome map
AA seq 492 aa AA seqDB search
MKNQVQLITYVDRITNAGLKELKALLDDELQGLFGGVHLLPFYFPIDGSDAGFDPIDHVQ
VDSRLGNWDDVKRIGDDYDIMADLIVNHMSAESPEFKDVLKHGKQSAYWDLFLTKDKVFP
EGLSEQDQATIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVHSAAGKDYLNRVLA
RFDHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANELGMTTLAEIHSHHMT
QVEIAKRVDMVYDFALPPLILHTLFSQDCQALTHWLEMAPRNCITVLDTHDGIGIIDAGP
MDGLRGLLTENQIDNLVETIHGNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYAGLLAIPNDMELLNNTHVGRDINRPYLNREKVQQAMQKPVVKA
LTKLIKLRNSSPAFDGRFTMASAERTLTLSWTAADSQASLTLDFANKDGQIILLDRQGKE
TQVSLSKLLAQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagtgcaactgatcacctatgtcgacagaattaccaatgccgggctcaag
gagctcaaagcgctactcgatgacgagttgcaaggtctattcggcggcgtacatcttttg
cctttctatttccccattgacggcagcgatgcaggcttcgatccgatagaccatgtgcaa
gtcgattcacgcttaggcaattgggatgacgttaaacgtattggtgacgactacgacatc
atggccgaccttatcgttaaccacatgtccgccgaatcgccagaatttaaagacgtgctt
aagcacggcaaacaatcggcttactgggatttatttttaaccaaagacaaggtatttcct
gaggggttaagcgagcaagatcaagccactatctatcgtccacgtccgggaagttgtttt
agcacttacaccttagccgatggctccaccgaagagttttggaccacctttacccgcaat
caaatcgatatcgacgttcattccgccgcgggtaaagattatttaaaccgagtgctggcg
cgtttcgaccacagtaaagtgaatctgatccgcttagatgcggcgggctatgcgattaaa
aagcccggcactagctgctttatgattgaagagtccttcgagttcgtggataagttagct
aagcaagccaatgagttaggtatgacaacgctggccgaaatccattcgcaccacatgact
caggtcgagatcgccaagcgggtcgacatggtgtacgacttcgcactgccaccgctcatc
ttgcacacgctgtttagccaagattgccaagccttgacccattggctggaaatggcgcca
cgcaactgcattaccgtactcgacacccacgacggcatcggcattatcgacgccggccct
atggatggcttgcgcggattattgaccgaaaatcaaatcgataatctggttgaaaccata
catggcaacagtaagggcgagagtctacaagccacaggcgcggccgccagcaacgtcgac
ttgtatcaaatcaactgcacctattacgatgccctcggtcagaatgacctagattatttg
atggcgcgggcgattcagtttttcgcacccggtattccgcaggtgtattacgcgggtctg
ctggcgattccaaacgatatggagctgctcaataacacccatgtcggtcgcgatatcaat
cgcccttacttgaaccgtgaaaaagtgcagcaagccatgcagaaacctgtcgttaaggcg
ctgactaaactgattaaactgcgtaatagcagcccagccttcgatggccgctttacgatg
gcatcagcagaacgcacgttaactttatcttggacagcggccgattcgcaggcaagtctc
accctcgactttgccaataaagatggccaaatcatccttttagataggcaaggtaaagag
acacaagtgtcgttatcaaaactgttggctcaagcataa

DBGET integrated database retrieval system