KEGG   Shewanella baltica OS195: Sbal195_0178Help
Entry
Sbal195_0178      CDS       T00622                                 

Definition
stearoyl-CoA 9-desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
sbn  Shewanella baltica OS195
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Sbal195_0178
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Sbal195_0178
Enzymes [BR:sbn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Sbal195_0178
Lipid biosynthesis proteins [BR:sbn01004]
 Desaturase
  First
   Sbal195_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(216246..217352)
Genome map
AA seq 368 aa AA seqDB search
MKKPPIIWLNVSLFAITFLSAVILVPWRGIVHGYGASEWIAFIVLAFASGLSITAGYHRL
WSHKAYKAHPAVRFMYALGGALALQNSALHWASDHRIHHKHVDDNDKDPYSAKMGFWYSH
IGWMLREYQSQRYHDYQNVRDLQNDRIVMWQHKHYLALVLLMNIGLPALLGWLNGDVLSM
LLMAGLLRLVVVHHCTFFINSLAHVWGSQPYTDKNTARDNGFLAMLTYGEGYHNFHHIFE
NDYRNGIKWWHYDPTKWLIKSLSWLGLAKDLRTSPQERIESARLQMQLLRTKNKVVHLPN
ADEIIEKVQAEYELLKLHLMDYYQAKKTLLEAKRKQLVDQQLLQQVEELKARFLVQQKHW
RSLTATYS
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaccccctatcatctggcttaatgtcagtctgtttgccatcactttcctcagt
gcggtgatcttagttccatggcgcggtattgttcacggctatggcgccagtgaatggatc
gcttttattgtcttagcctttgccagtggtttgtcgatcaccgcaggttatcacagactg
tggtcacacaaggcctataaagcccatccagccgtgcggtttatgtatgcactcggtggt
gctttagcattacaaaacagtgcattacattgggcatccgatcacagaatccaccacaag
cacgtagacgacaacgacaaagacccgtactcagccaaaatgggattctggtacagccat
atcggttggatgctgcgtgagtaccagtcgcaacgctatcatgattatcaaaatgtgcgc
gatctgcaaaatgaccgtatcgttatgtggcaacacaaacattacctcgcactcgttttg
ctgatgaacattggactgcctgccctgctcggctggctgaacggcgacgtactgtctatg
ttattgatggcgggtttactgcgtttagtggtggtgcatcactgcactttcttcatcaac
tctttagcccacgtgtggggcagccagccttataccgataagaacactgcccgcgataat
ggctttctcgccatgctgacctacggtgagggttaccataatttccatcacatcttcgaa
aatgactatcgtaatggcattaaatggtggcactacgatccaactaaatggttgattaag
tcattatcttggttggggttagccaaggacttgcgtacgagtccacaggaacgtatcgag
agcgcacgcttgcagatgcagctgctgcggaccaagaataaagtcgtgcacttacccaat
gccgatgaaattattgaaaaagtccaagctgagtatgaattactcaagctgcacttaatg
gattactaccaagcgaagaaaaccttgcttgaggccaagcgtaaacaacttgtcgatcag
cagctattgcagcaagttgaagagctaaaagcgcgtttcttagtccagcaaaaacattgg
cgaagcctaaccgcaacttatagctaa

DBGET integrated database retrieval system