KEGG   Shewanella baltica OS195: Sbal195_0660Help
Entry
Sbal195_0660      CDS       T00622                                 

Definition
aldose 1-epimerase
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
sbn  Shewanella baltica OS195
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal195_0660
   00052 Galactose metabolism
    Sbal195_0660
Enzymes [BR:sbn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sbal195_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(803328..804362)
Genome map
AA seq 344 aa AA seqDB search
MVRFSVLDPWTDPRGGEIERVRIDNGILALEVISLGGIIRALWTPDKHGERANIVLGCDS
AEDYLTQSAHLGAIAGRFANRIANGKMHYQGQDYQLDVNQATNCLHGGREGFNRKNWHLG
QLPDGVRLTLMSPDGDMGFPGNCTVQLDYRLAGNNLYVEILASVDKACPVSLTQHSYFNL
DGSETNHEHLMQIDAKRYLTMNDVSVPTGIAETAGSIFDLSQPIRLGDKLHAAELANTRG
YDHCYMMNDPDGSLARFGCLSSPVSGRAMTVYTNQPSVQLYCANFLDGTVGRNQQVLNQH
HGVCLEPQMLPDSPNQGERFGDDVWLVPGKVYHHISRYQFDADA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtttcagtgttttggatccttggaccgatccccgcggcggcgaaatcgaacgg
gttcggatcgacaatggcatactcgcattagaagtcatcagcttaggcggaattatccgt
gctctgtggaccccagataaacacggcgaacgagccaatatcgtccttggttgcgacagc
gccgaagactacctgacgcaatcggctcacttaggcgccattgctggccgctttgcgaat
cgtatcgctaacggcaaaatgcactatcaaggtcaagattatcaactcgatgtcaaccaa
gcgactaactgtttgcatggcggccgtgaagggtttaaccgtaaaaactggcacttaggc
caactgcccgatggtgtgcgcttgaccttaatgagtccagacggcgacatgggtttcccc
ggtaattgcacggttcagctggattatcgcctcgcaggcaataatctctatgtggaaatt
ttagcttcggtggataaagcctgtcccgtgagcttaacccagcacagttatttcaacctc
gatggttcagagaccaatcacgagcatttgatgcaaatcgatgccaagcgttatctcacc
atgaatgatgtcagtgttcccactgggattgccgagactgcaggatcgattttcgacttg
agtcagccgatacgcttaggcgacaaactgcatgccgctgaattggcgaacacgcgcggt
tatgatcactgttatatgatgaatgaccccgacggttcactcgcccgctttggctgttta
agtagtcctgtgagtggccgcgctatgacggtttataccaatcaaccgagcgtgcagctc
tactgcgctaactttttagatggcactgtgggtcgcaatcaacaggtattaaatcaacat
catggcgtgtgtttagaaccgcagatgctgccagactcaccgaatcaaggcgagcgcttt
ggtgatgatgtttggttagtgccaggcaaggtttatcaccacatcagccgatatcagttc
gatgccgatgcgtaa

DBGET integrated database retrieval system