KEGG   Shewanella baltica OS195: Sbal195_0660Help
Entry
Sbal195_0660      CDS       T00622                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00010  Glycolysis / Gluconeogenesis
sbn00052  Galactose metabolism
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal195_0660
   00052 Galactose metabolism
    Sbal195_0660
Enzymes [BR:sbn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     Sbal195_0660
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ABX47838
UniProt: A9L0A9
Position
complement(803328..804362)
Genome map
AA seq 344 aa AA seqDB search
MVRFSVLDPWTDPRGGEIERVRIDNGILALEVISLGGIIRALWTPDKHGERANIVLGCDS
AEDYLTQSAHLGAIAGRFANRIANGKMHYQGQDYQLDVNQATNCLHGGREGFNRKNWHLG
QLPDGVRLTLMSPDGDMGFPGNCTVQLDYRLAGNNLYVEILASVDKACPVSLTQHSYFNL
DGSETNHEHLMQIDAKRYLTMNDVSVPTGIAETAGSIFDLSQPIRLGDKLHAAELANTRG
YDHCYMMNDPDGSLARFGCLSSPVSGRAMTVYTNQPSVQLYCANFLDGTVGRNQQVLNQH
HGVCLEPQMLPDSPNQGERFGDDVWLVPGKVYHHISRYQFDADA
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atggtacgtttcagtgttttggatccttggaccgatccccgcggcggcgaaatcgaacgg
gttcggatcgacaatggcatactcgcattagaagtcatcagcttaggcggaattatccgt
gctctgtggaccccagataaacacggcgaacgagccaatatcgtccttggttgcgacagc
gccgaagactacctgacgcaatcggctcacttaggcgccattgctggccgctttgcgaat
cgtatcgctaacggcaaaatgcactatcaaggtcaagattatcaactcgatgtcaaccaa
gcgactaactgtttgcatggcggccgtgaagggtttaaccgtaaaaactggcacttaggc
caactgcccgatggtgtgcgcttgaccttaatgagtccagacggcgacatgggtttcccc
ggtaattgcacggttcagctggattatcgcctcgcaggcaataatctctatgtggaaatt
ttagcttcggtggataaagcctgtcccgtgagcttaacccagcacagttatttcaacctc
gatggttcagagaccaatcacgagcatttgatgcaaatcgatgccaagcgttatctcacc
atgaatgatgtcagtgttcccactgggattgccgagactgcaggatcgattttcgacttg
agtcagccgatacgcttaggcgacaaactgcatgccgctgaattggcgaacacgcgcggt
tatgatcactgttatatgatgaatgaccccgacggttcactcgcccgctttggctgttta
agtagtcctgtgagtggccgcgctatgacggtttataccaatcaaccgagcgtgcagctc
tactgcgctaactttttagatggcactgtgggtcgcaatcaacaggtattaaatcaacat
catggcgtgtgtttagaaccgcagatgctgccagactcaccgaatcaaggcgagcgcttt
ggtgatgatgtttggttagtgccaggcaaggtttatcaccacatcagccgatatcagttc
gatgccgatgcgtaa

DBGET integrated database retrieval system