KEGG   Shewanella baltica OS195: Sbal195_0696Help
Entry
Sbal195_0696      CDS       T00622                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sbn  Shewanella baltica OS195
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal195_0696
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sbal195_0696
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal195_0696
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sbal195_0696
Exosome [BR:sbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal195_0696
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
843846..845483
Genome map
AA seq 545 aa AA seqDB search
MNKKLLVVAISAMLGLAACGSDGDNGTAGTPGSNGSNGSNGSNGKDWTAVNQWYVDAQAR
VTKAEGLTVNNDVGAAKNVILFVGDGMGVSTITAARILEGQLKGKTGEENSLSFETLPYV
GLSKTYNVDGQTPDSAGTMSAMMTGVKTDVGVISQAEGVVRANCASTKDQNLVTSLELAA
MAGMATGVVTTARLTHATPAATYAHVPERDWEADSNLPAEAVTNGCKDIAAQMLDFNYGS
GLNVMMGGGRRAFIPKTTVDPEGKAGKRNDGRDLTAEWMTKYTNAAYVQDRDGFLSVDAA
STDHLLGLFNSSHMEYDYDRKEAGVTGEPSLAEMTAKSIDILKKNSKGFVLIVEAGRIDH
AHHAGNAARALYDTVALSEAVRVAMEKTSANDTLLMVTADHSHVFTIAGYPTRGNPILGL
VKSNDANGVAEVTNSTDANGLPYTTVGYANGMGYASLATGGDERYNFPVDAGRKDLNFVD
TQSAGFHQEALVPLSDETHAGEDVAIFARGPSSDLIQGTVEQNHIFHVMNRAANLVAKAE
AAAVK
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgaataagaaattactagtagtcgcgatttcagccatgctgggtttagccgcatgcggt
agcgatggtgataacggtaccgcgggaacaccgggtagcaatggatcaaatgggtctaac
ggtagcaatggcaaagattggactgctgtgaatcagtggtatgtcgatgcacaagctcgc
gtgaccaaagccgaaggcttaactgttaacaatgatgttggcgccgcgaaaaacgtgatc
ctgtttgtgggtgatggtatgggtgtatcaaccattactgccgcacgtattttagaaggc
cagctcaaaggcaaaacgggcgaagaaaactcgttatctttcgaaactctgccttatgtg
ggtctttctaaaacctataacgtcgacggccaaacgccggattctgcaggcactatgtcg
gcgatgatgacaggtgtcaaaaccgacgtaggcgtgatttcacaggctgaaggcgtagta
cgtgctaactgtgcttcgactaaagatcaaaatttagtgacgtcactcgagcttgccgca
atggcgggaatggcaacgggtgtggtgacaacggcgcgtttaacccacgcaactcctgcg
gcgacttacgcccatgtgccagaacgtgattgggaagccgattcaaacctgccagccgaa
gctgtgactaatggctgtaaagatatcgccgcgcaaatgctcgactttaactacggcagc
ggtcttaacgtgatgatgggtggcggtcgccgcgcctttattcctaagacgaccgttgat
ccagaaggtaaagcaggtaagcgtaacgatggtcgtgacctcacagctgaatggatgact
aaatacactaacgccgcttacgtgcaagacagggacggtttcctcagtgtggatgcggca
agcacagatcatttgctgggcctattcaactcatcgcacatggaatacgactacgatcgt
aaagaagctggcgtgactggcgagccatcactggcggaaatgacggctaagtcgattgat
attctgaagaaaaactcaaaaggcttcgtgttgattgttgaagctggccgtatcgaccac
gctcaccatgcaggtaatgcggcgcgtgcgctgtatgacacagttgcgctttctgaagcg
gtgcgtgtggcgatggaaaaaacctcggcaaacgataccttgttaatggttacagcggat
cacagccatgtgttcaccattgcaggttatccaactcgcggtaaccctatcctaggttta
gtgaagtcgaacgacgccaacggcgttgctgaagtgactaactctaccgatgctaacggt
ttgccatataccacagtcggttacgctaacggcatgggctatgcgtcattagcaacaggt
ggcgatgagcgttacaacttcccagtggacgcaggtcgtaaggacttgaactttgttgat
acccaaagtgccggattccaccaagaagcgctagtgccattaagtgacgagacccatgca
ggggaagacgtagcgattttcgcccgcggcccaagttcggatcttatccaaggtacggtt
gagcagaaccacattttccacgtgatgaaccgcgcggcaaatttagtggctaaagctgaa
gcggctgcggttaagtaa

DBGET integrated database retrieval system