KEGG   Shewanella baltica OS195: Sbal195_0879Help
Entry
Sbal195_0879      CDS       T00622                                 

Gene name
panC
Definition
pantoate--beta-alanine ligase
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
sbn  Shewanella baltica OS195
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Sbal195_0879 (panC)
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Sbal195_0879 (panC)
Enzymes [BR:sbn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.1  pantoate---beta-alanine ligase
     Sbal195_0879 (panC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1040823..1041668)
Genome map
AA seq 281 aa AA seqDB search
MITSAHIDDIRTQVRAWRAKGETVAFVPTMGNLHQGHITLVKEAASKCDHVVASIFVNPM
QFGQNEDLDAYPRTLAADSEALTAAGAELLFTPTPAVMYPKGLEQQTYVEVPGISNVLCG
ASRPGHFRGVATIVCKLFNIVQPDVALFGNKDYQQLLVIKTMVEDLSLPIEIIGVDTIRE
DSGLAMSSRNGYLTAAEKAAAPALKQAIDAMAAGIKQGESFEQMTEQAKACLVAAGFTPD
YLEIRHAHTLEQAQNQDHALVILAAAYIGKARLIDNLRFDR
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgatcactagcgcccatattgatgatattcgcacccaagtgcgtgcatggcgtgccaag
ggcgaaaccgtcgcctttgtgcctaccatgggtaatctccatcagggacacattacttta
gtcaaagaagccgcgagcaagtgtgaccatgtggtggcctctattttcgttaatccaatg
caatttggtcagaacgaagatctggatgcttacccacgcacactcgctgccgacagcgaa
gccctcacggccgctggcgctgagctattattcaccccaacgccagccgtgatgtatccc
aagggtctagagcaacaaacctatgtcgaagtcccagggatttccaacgtgctttgtggt
gcgagtcgtccggggcatttccgtggcgttgcgactatcgtttgtaaactgtttaacata
gtacagcccgatgtggcgctattcggtaataaagactatcaacagctattagtgatcaaa
actatggttgaagacttgtcattgccgattgaaattatcggtgtcgataccatacgtgag
gactcaggtttagccatgagttcacgcaatggttacctcactgccgcagaaaaagccgca
gcgcctgcgctaaaacaagccatagacgccatggccgcagggattaagcaaggcgaaagc
tttgagcaaatgactgagcaagcaaaagcctgtttagtcgcggctggttttacgccggat
tacctcgaaattcgccacgctcacacgcttgaacaagcccagaaccaagaccacgcttta
gtgattttagctgcggcctatataggcaaagcgcgacttatcgataacttaagattcgat
cgctaa

DBGET integrated database retrieval system