KEGG   Shewanella baltica OS195: Sbal195_1147Help
Entry
Sbal195_1147      CDS       T00622                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
sbn  Shewanella baltica OS195
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sbal195_1147
Enzymes [BR:sbn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sbal195_1147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1359208..1361574)
Genome map
AA seq 788 aa AA seqDB search
MTQIHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHTDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRSFIYLVGPGHGFPAVQANLFMEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLIGDGEAETGPLAASW
YANRLVSPATSGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYFPIIVDNELEED
IYVQMTNAMDTAYAMINDIQRRARSGEDVVKPKWPVILMRTAKGWTGVSEYKGKKLEGNC
ESHQVIVNKCATDKGHLDALDNWLASYHFQELYQMNDKGELIFDADICSLIPPKQLACGR
QHLTYGGEVVRALTNPDLEKLSYGPEVPRGHRGYSMLKMGEWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSREGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVISSMADQYCKYVYASQGVHFRKPLPSCNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAYADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVLIRELLPRVKIRFVSVTELSSDGL
GSRKFKEKPWLMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETMHVSITTDMLQRLVDHRNYIKANGVDPIE
IENWIWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatacatgaaatcaatgctctgaaaaaatatgtcagagcgactaactttctt
gcgacctcgcagatttatctcaaacaaaacgtcttacataaacgtccacttgcacatact
gatatcaaaccacgtttacttggccactggggtacctgccctggcattaactttgtttat
gccaacattaaccgattgatagtgaaacataaccgctcgttcatctatttagttggtcct
ggccatggtttcccagcagtacaagctaacttattcatggaaggttcattaagtcatttc
tatccagaaacgatcccctacaatgaaacgggtatcgaagatatttgtaagaagttttcc
gccgcttatggctacccttctcatgcaaacccagaagctccaggacaaattcttgaaggt
ggcgaactaggctactcactttctgttggctggggtgcagtactcgataatccagatctg
atcgccacagtcttaattggtgacggtgaagcagaaaccggaccattagccgcgtcttgg
tacgcaaaccgtctagtctctcctgcgacaagtggtgcagtattaccgattgtgcatatc
aatggctataaaatttcaggccctacccgtatgggacgcatgagtcatgaagaactggat
cttgaattccgtggtcttggctacttccctattatcgttgataacgaattagaagaagat
atctatgtgcagatgacgaatgccatggataccgcttatgccatgatcaatgatatccaa
cgtcgtgcccgtagcggtgaagatgtggttaagcctaaatggccagtgattttaatgcgc
accgccaaaggttggacgggtgtcagtgagtataaaggtaagaaattagaaggtaactgc
gaatcacaccaagtgatcgttaataaatgtgccacagataaaggtcatctggatgcactc
gacaattggcttgccagttaccacttccaagaactttaccaaatgaatgataaaggcgag
ctgatttttgatgcagacatttgctcattaattccacctaagcaacttgcctgtggtcgt
caacatctcacctatggtggtgaagtggttagagcgttaacgaaccctgatctcgagaaa
ctcagctacggcccagaagtaccacgtggtcaccgtggttattcaatgttgaaaatgggt
gaatggatgcgtgatgcattcaagttaaaccgcgatcaacgcaatctacgtattttcagc
cctgacgaaacctattcaaatcaactacaagccgtatttgaagaaaccgatcgtgcatgg
caatggccaattgagagctgggatgaagacatgtcccgcgaaggacgagtgattgagctc
ctttctgaaaacttgctctttggtatgttgcacggctacacagtaacaggccgccacggc
atgttccctacgtatgaatcattctcacaagtgatctcatcgatggccgaccaatactgt
aaatacgtctatgcaagccaaggcgtgcatttccgtaagccactgccttcatgtaacgtc
gtattatcttcgctgcttgaacgccaagaccataatggctactcgcatcaaaacccgtct
ttccttggggctatgctagagaagcatccaaaaattatctctgcttatttaccagcagat
gctaacagcaccttggtttataccgaacgggcttacgctgaccgcgacaaactcaatatt
cttgttgcaggtaagaaagagttaccacaatggctgagcttggaagaagcgcgtaaacaa
gcaaaagatggcgtgatggtgtgggatttcgcctctgatgagaatccagatattgtgctg
gcaggttgtggtgattacgtcactcaagagtgtatggcttcattagtattgatcagagaa
ctccttccaagagtcaaaattcgcttcgttagcgtcaccgaattaagcagtgatggctta
ggaagccgcaaatttaaagaaaaaccttggttaatggacgaaatatttacccaagataaa
ggcgtggtattcaactaccatggttacccaaatacgattaaaaagttaatatttgattac
aaaggcagccgtcgcttcagaattaaaggctatgaagaagaaggttcaacaaccactcca
ttcgatatgggcgttcgtaacggcacatcacgttatcacctagtgattgatatggcttac
aaactgttccaacagggcgttattgatgaaactatgcacgtttctataaccactgacatg
ctgcaaagactagttgaccaccgcaactacattaaagcgaatggtgtcgacccaatagaa
attgaaaattggatatggacacgttaa

DBGET integrated database retrieval system