KEGG   Shewanella baltica OS195: Sbal195_1228Help
Entry
Sbal195_1228      CDS       T00622                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sbn  Shewanella baltica OS195
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1463272..1463775
Genome map
AA seq 167 aa AA seqDB search
MARIYISLGSNIEPEQHLQAGLTSLRACFGPLRLSSMYESEAVGFSGTNFLNMVASAETD
LNIAAVVAQFKQIEQNHGRLAGAKKFSPRTLDLDLLLYDHVVCQTPVVLPRAEIVNNAFV
LWPLAELAPELIHPVVDKSYASLWQEYDKNSQRLWPVTFEWPPGLTF
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtatttatatcagtctgggtagcaatatcgagcctgaacagcatctgcaagca
ggattaacatcgctgcgagcgtgtttcgggccgctgcgcctctcttctatgtatgaaagt
gaagcggtaggtttcagtggcactaactttttgaatatggttgctagcgctgaaactgat
cttaatatagcggcggtagttgcacagtttaagcaaatcgagcagaatcacggccggctt
gccggggcgaagaaatttagcccaagaaccttagatttagacctgctgctttatgaccat
gtggtatgccaaacgcctgttgtgctgccccgtgctgagatagtcaataatgcctttgtg
ttatggcctttagctgagttagcgccggaattgattcatcccgtggtagataaaagctat
gcaagtttgtggcaagagtatgacaaaaattcacagcgactttggcctgtgacgtttgaa
tggcccccagggctgacgttttaa

DBGET integrated database retrieval system