KEGG   Shewanella baltica OS195: Sbal195_1306Help
Entry
Sbal195_1306      CDS       T00622                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbn  Shewanella baltica OS195
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal195_1306
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal195_1306
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sbal195_1306
Enzymes [BR:sbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sbal195_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1547026..1548309
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGQDRGLFFPTQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDELVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAI
SSDFDACQDLVKRAFDDPEVREGLSLNSANSINISRLLAQVCYYFEAVAQSKQGHDADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLENGQWQPNQTQATMSNAMD
VSEPSNWPRVEAICEKLAWPLSNLVGMRLSEEQTSLALAELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELDLNLPLPVELEAVAHKPILSAELPADFTALKA
HLFKILT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagcttcaaagaagcagtgcaa
ttagggttaggtcaggacagaggtttgttctttcctacccaaattccggtattagacgat
attgaagggctgctggcgctgccatttgttgagcgcagtaaaaaagtgctcggtgcatgg
cttgcctctgaattagggcaagatgcagttgatgaactggttgaacgtgcctttaacttc
gatttacctttagttgccgtcgatgagcagcgcgcttgcctcgaattgttccacggtcct
actctggcatttaaagattttggtgcgcgttttatggcgcaatgcgtcaatgcctttgtc
ggcgacacacgcttaaccattctgactgcgacttcgggtgatactggcgccgcggttgcc
gatgccttttatgggcttgaaaaagtcaatgtggtggtgctctatcctaagggtaagata
agtgagctacaggaaaagatgttcacaacgttgggcaaaaacatccatacagttgccata
tcgtccgattttgatgcctgccaagacttagttaaacgcgcctttgatgatccagaagtc
cgcgaggggttgagcttaaattcggcgaactctattaatatcagccgcttacttgcgcaa
gtttgttattactttgaagccgttgcccagtctaaacaaggccacgacgccgatcctgtg
atttcagtgccaagtggtaactttggtaacctgacagcgggtttattcgccaaagccatg
gggttaccggttaaacgctttatcgccgcaaccaatgcgaatgatactgtgccgcgctat
ttagaaaacggccaatggcagcccaatcaaacccaagcgaccatgtctaatgcgatggat
gtgagtgagccaagtaactggccgcgagtggaagccatttgtgagaaattagcttggccg
ctgagtaacttagtgggcatgcgtttatctgaagagcaaacttcactggcattagctgag
ttgcatgcacagggttatgtgtctgagccccatgcggcgattgcagctaaagccttgtct
ttaaccttagtgcctgacgaagtgggtatattcttaggtacggcgcatcccgctaaattt
aaggatgtggtcgatagagagctagatcttaacttaccactgccggttgagcttgaggcc
gttgcccataaacctattttatcggctgaattacccgctgattttacggcactgaaagcg
cacttattcaagatcttaacctaa

DBGET integrated database retrieval system