KEGG   Shewanella baltica OS195: Sbal195_1306Help
Entry
Sbal195_1306      CDS       T00622                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbn  Shewanella baltica OS195
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal195_1306
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal195_1306
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sbal195_1306
Enzymes [BR:sbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sbal195_1306
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1547026..1548309
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGQDRGLFFPTQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDELVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAI
SSDFDACQDLVKRAFDDPEVREGLSLNSANSINISRLLAQVCYYFEAVAQSKQGHDADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLENGQWQPNQTQATMSNAMD
VSEPSNWPRVEAICEKLAWPLSNLVGMRLSEEQTSLALAELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELDLNLPLPVELEAVAHKPILSAELPADFTALKA
HLFKILT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagcttcaaagaagcagtgcaa
ttagggttaggtcaggacagaggtttgttctttcctacccaaattccggtattagacgat
attgaagggctgctggcgctgccatttgttgagcgcagtaaaaaagtgctcggtgcatgg
cttgcctctgaattagggcaagatgcagttgatgaactggttgaacgtgcctttaacttc
gatttacctttagttgccgtcgatgagcagcgcgcttgcctcgaattgttccacggtcct
actctggcatttaaagattttggtgcgcgttttatggcgcaatgcgtcaatgcctttgtc
ggcgacacacgcttaaccattctgactgcgacttcgggtgatactggcgccgcggttgcc
gatgccttttatgggcttgaaaaagtcaatgtggtggtgctctatcctaagggtaagata
agtgagctacaggaaaagatgttcacaacgttgggcaaaaacatccatacagttgccata
tcgtccgattttgatgcctgccaagacttagttaaacgcgcctttgatgatccagaagtc
cgcgaggggttgagcttaaattcggcgaactctattaatatcagccgcttacttgcgcaa
gtttgttattactttgaagccgttgcccagtctaaacaaggccacgacgccgatcctgtg
atttcagtgccaagtggtaactttggtaacctgacagcgggtttattcgccaaagccatg
gggttaccggttaaacgctttatcgccgcaaccaatgcgaatgatactgtgccgcgctat
ttagaaaacggccaatggcagcccaatcaaacccaagcgaccatgtctaatgcgatggat
gtgagtgagccaagtaactggccgcgagtggaagccatttgtgagaaattagcttggccg
ctgagtaacttagtgggcatgcgtttatctgaagagcaaacttcactggcattagctgag
ttgcatgcacagggttatgtgtctgagccccatgcggcgattgcagctaaagccttgtct
ttaaccttagtgcctgacgaagtgggtatattcttaggtacggcgcatcccgctaaattt
aaggatgtggtcgatagagagctagatcttaacttaccactgccggttgagcttgaggcc
gttgcccataaacctattttatcggctgaattacccgctgattttacggcactgaaagcg
cacttattcaagatcttaacctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system