KEGG   Shewanella baltica OS195: Sbal195_1357Help
Entry
Sbal195_1357      CDS       T00622                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbn  Shewanella baltica OS195
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal195_1357
Enzymes [BR:sbn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sbal195_1357
Exosome [BR:sbn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal195_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1616721..1618952
Genome map
AA seq 743 aa AA seqDB search
MMTQANAYFYDGADVALLNGQYTDVFSLLGMHSANEGKALIVRCFLRNALSVDVISIKDG
RKVASLDKVNEQGLFAGTLGRRVKPFLYLLRVEYPLCQLDIVDPYQFDSLLNSDDIYLFG
EGSAERAYEFLGANWRQTQGVEGVHFCVWAPNAKRVSVVGDFNHWDDTRHVMRQHLANGL
WELFLPNVVEGAHYKFDLVYQNGERHTKSDPMATQMECAPHNASIVPPKAHHSWNDTAWM
SKRAATAWHKAPMSAYEVHLGSWRRKGEQGEQYLDYQDLIEQLIPYVKEQGFTHIELMPI
SEFPFDGSWGYQPVGLYAPTHRFGDANGLKAFVDACHQAGIGIILDWVSAHFPKDPHGLV
RFDGTCLYEHEDPRKGTHPDWDTLIYNYDRGEVRSFLLSNACYWLREFHFDGLRLDAVSS
MLYLDYSREPGQWLPNAYGGRENLEAISFLQILNQRLYQAFPGICMIAEESTAFAGVTKP
TDQQGLGFGFKWNMGWMNDSLSYLGRDPLYRQFHHHQLTFSLMYAYTEQFMLSVSHDEVV
HGKGSLLHKIPGDDWQKFATLRAYYGFMWGHPGKKLLFMGCEFGQRNEWNHNQSLDWHLL
AYEPHQGVQRWLKDLNQLYQDMPALSVQDYEGAGFSWLDCENSRDSIFTFVRYGLAGDAP
LVFVINMTPQLHTGFRIGLPLAGDYREYLNSDSQIYGGSNQGNAGTVVAESLPWQGMAQS
ALITVPPLGCLVIGPATGLAEAN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcaagccaatgcctatttctacgatggcgccgacgtcgccctacttaatggt
caatacactgatgttttttcgcttttgggtatgcacagtgccaacgagggtaaggcatta
attgttcgttgttttttacgcaatgccctcagtgtggatgtgatcagcattaaagatggc
cgtaaagtagcgagtctggacaaagtcaacgagcagggactgttcgccggtactctgggg
cgacgcgtcaaaccgtttctctatttgctgcgggtagaatatcccctgtgtcagttagat
atagtcgacccttatcagtttgattcattgcttaatagtgacgatatttacctgtttggt
gaaggcagcgccgagcgcgcctatgagtttttaggcgccaactggcgtcagacccaaggc
gttgaaggtgtgcatttttgtgtgtgggcacccaatgccaaaagggtctctgtggtgggg
gatttcaaccattgggacgatactcgccatgtaatgcgccaacatcttgccaatggtttg
tgggagctatttctgcctaatgtggttgaaggcgcccactataagtttgatttggtttat
caaaatggtgagcgtcataccaagtccgaccccatggcgactcaaatggaatgcgcgccc
cataatgcttctatcgtgcccccaaaagcccatcacagttggaatgataccgcttggatg
agtaaacgcgcggcgactgcttggcataaagcgcccatgtcggcctacgaagtgcactta
ggttcgtggcgtcgtaagggagagcaaggcgagcaatatcttgattatcaagacttgatt
gaacagcttattccctatgtgaaggagcaaggttttacccacattgaactgatgccgatc
agcgagtttcccttcgatggttcgtggggatatcagcctgtgggtctctatgcaccgacc
cacagatttggcgatgccaatgggttaaaagcctttgtggatgcctgccatcaggcggga
attggtatcatcctcgattgggtgtcggcacattttcctaaggatccccacggcttagtg
cgtttcgatggcacttgtttgtatgagcatgaagatcctcgcaagggcacacatcccgat
tgggataccttgatttataactatgatcgcggtgaagtgcgcagtttcttgttgagtaat
gcctgttactggctgcgggagttccactttgatggcctgcgtctcgatgccgtgtcttct
atgttgtacctcgattacagccgcgagccgggccaatggctgcctaatgcctatggtgga
cgggagaatctcgaagccattagtttcttacaaattttgaatcaacgcctataccaagct
ttccccggcatttgcatgatcgccgaagagtccaccgcctttgcgggggtgactaaaccg
acggatcagcaaggtctcggctttggctttaaatggaacatgggctggatgaatgacagc
ttaagctacttaggccgagatccgctttaccgccaattccaccatcatcaattgaccttc
agtttgatgtacgcctataccgagcaatttatgttgtcagtgagtcacgatgaagtggtc
cacggcaagggctcgttgctgcataaaattcccggtgacgattggcagaaatttgcgacc
ctgcgtgcttattacggttttatgtgggggcatcccggtaagaaattactctttatgggc
tgcgagtttggtcagcgaaatgagtggaaccataaccagagtttagattggcacttattg
gcttatgaaccgcaccaaggtgtgcaacgttggcttaaagatctcaatcaattatatcaa
gacatgcctgctttatcagttcaggattacgagggggcaggattcagttggctagattgt
gaaaatagccgcgatagcatctttacctttgtgcgttacggcttagcgggtgatgcgccg
ttagtgtttgtcatcaacatgacgccccaattgcacactgggttccgtattggtttgccc
ttggcgggggattaccgcgaatacctgaatagcgatagccagatttatggtggcagtaac
caaggtaatgcgggcactgtcgttgctgagtcgctgccgtggcagggcatggcgcagagc
gcgctgatcactgtgccgcccttgggttgtctagtgattgggcctgcaactggattggct
gaggcgaactag

DBGET integrated database retrieval system