KEGG   Shewanella baltica OS195: Sbal195_1407Help
Entry
Sbal195_1407      CDS       T00622                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbn  Shewanella baltica OS195
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sbn00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sbn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1688453..1688950)
Genome map
AA seq 165 aa AA seqDB search
MEVNMTTNIYSQSATDIQGNTVSLEQYRGKVLLIVNTASECGFTPQYKGLEALYQEYKDQ
GLVILGFPCNQFGAQEKADEQGIQAFCELNFGVTFPLFSKIEVNGEHTHPLYQYLKKAAP
GVLGTQGIKWNFTKFLVNRRGEAIERFASTTKPEALESKIAALLK
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atggaggtgaacatgactacgaatatatacagccaatcagcgacagacattcaaggcaac
acagtaagtttagagcagtatcgaggcaaagtactcttgatcgtcaacaccgccagtgaa
tgtggatttacaccgcaatacaagggattagaagcgttatatcaagaatataaagatcaa
ggattagtgattttaggctttccttgcaatcaatttggcgcccaagaaaaagccgatgag
caaggtattcaagccttttgtgaattgaattttggcgtgacgtttccgctattttctaaa
atagaagtgaatggcgaacatacccatccactttatcaataccttaagaaagccgctccc
ggtgtattaggtactcaaggtatcaaatggaatttcaccaaatttttagttaatcgccga
ggcgaagctattgaacgatttgcatcgaccacgaaacccgaagcattagaaagtaaaatt
gccgctttgctaaaataa

DBGET integrated database retrieval system