KEGG   Shewanella baltica OS195: Sbal195_1433Help
Entry
Sbal195_1433      CDS       T00622                                 

Definition
(GenBank) ROK family protein
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00010  Glycolysis / Gluconeogenesis
sbn00052  Galactose metabolism
sbn00500  Starch and sucrose metabolism
sbn00520  Amino sugar and nucleotide sugar metabolism
sbn00521  Streptomycin biosynthesis
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01120  Microbial metabolism in diverse environments
sbn01130  Biosynthesis of antibiotics
sbn01200  Carbon metabolism
Module
sbn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal195_1433
   00052 Galactose metabolism
    Sbal195_1433
   00500 Starch and sucrose metabolism
    Sbal195_1433
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal195_1433
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sbal195_1433
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Sbal195_1433
Enzymes [BR:sbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sbal195_1433
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Pan_kinase Hexokinase_1
Motif
Other DBs
NCBI-ProteinID: ABX48607
UniProt: A9KUF8
Position
complement(1719332..1720174)
Genome map
AA seq 280 aa AA seqDB search
MSVLCLDLGGTKLMLAQVEGKTLLDTWRYPVPADGNFEQLFDFLVTCIHSHLTPETYGIS
IGIPGMVDMQSGTLLEVLNIPALTATQLAQQLKNTFEMDVVVNNDANLFALGEAVLNRNQ
DMLGITLGTGVGAGVIFNGQLYSGKHCAAGEIGSLSYRDGIIEHYCSGQYFTTHHHMSGE
HLYQKACEGDSQALQAFAHFGEHLAHMIAQTLLVYDPKDIILGGSVSQSFPFFIEALNQK
LQSLVYGPQLADLTISASQHHNAALIGAAQWFLQQKDSVK
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctatgtttagatcttgggggaactaaactgatgttggcacaggtggaaggt
aaaaccttactcgacacttggcggtatcccgttcccgccgatggcaatttcgaacagtta
ttcgatttcctcgtgacctgtatccacagccatctcacgcctgaaacctatggtatttcc
atcgggatacccggcatggtggatatgcaaagcggcactttactcgaagtgctcaacatc
cctgcgttgacggcaacgcagttagcccagcaacttaaaaatacctttgaaatggatgtg
gttgtgaataacgacgctaacctctttgcccttggcgaagctgtgctcaatcgcaatcaa
gacatgctcgggattaccttaggcacaggcgtgggcgctggggtgatttttaatggtcag
ttgtattcgggtaaacattgcgccgcaggtgaaatcggcagtttgagttatcgcgatggc
ataattgagcactattgctcggggcaatacttcaccactcatcaccacatgagtggcgag
catttgtaccaaaaagcctgtgaaggagacagccaagcgctacaagccttcgcccatttt
ggtgaacacttggcgcacatgatcgcccaaaccttactggtatacgatcccaaagatatc
atccttggcggctcagtcagccaaagctttcccttctttattgaagcgcttaatcagaaa
ttgcaaagcttagtctatggcccccaactggcggacttgacgatttcagccagccaacat
cacaatgcggcactcattggcgcggcacaatggtttttacaacaaaaggactcagttaag
tga

DBGET integrated database retrieval system