KEGG   Shewanella baltica OS195: Sbal195_1505Help
Entry
Sbal195_1505      CDS       T00622                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbn  Shewanella baltica OS195
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sbn00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1815402..1816208
Genome map
AA seq 268 aa AA seqDB search
MTDKTTIAQTLTKQDLLQVVAIAKAAGDAIMTVYGQDDFSVSHKGDDSPVTAADLAAHHV
IVAALAKQFVGIPIMSEEAADIAWDERRQWQTYWLIDPLDGTKEFIKRNGEFTVNIALIH
QGVAIAGVVYAPVLDTYYYGAKHLGAWRQQAGQESPLLGAKAPRAMPMIVGSRSHLSPGL
AQYLQQFGEHDILSVGSSLKFCMLAEGSADLYPRLGPTSEWDTAAAQAVLESAGGTVVCY
DSGEPLTYNQKPDILNPYFIATAPGWVK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgacagacaagacgacaatagcgcagacattgaccaaacaagatctactgcaagtggtc
gcgattgccaaagccgcaggcgatgccattatgacggtttatggtcaagatgacttttca
gtgagccataagggcgatgatagtcccgtgacagcggccgatttagccgcgcaccacgtg
atagtggcggcattggcaaagcagtttgtcggtattcctattatgtctgaggaagcggcg
gatattgcgtgggatgagcgtcgtcaatggcaaacctattggttaattgaccctttagat
ggcactaaggaatttattaagcgcaatggtgagtttaccgtcaatattgcgcttatccat
caaggggttgcaatcgcaggagtggtatatgcgcctgtgctcgatacctattattacggc
gctaagcatttaggtgcatggcgtcaacaagcgggtcaagaaagtcccttattgggcgct
aaagcgccacgcgcgatgccgatgattgttggcagtcgctcgcacttgagccctggttta
gcgcaatatttacaacagtttggcgagcatgacatcttaagcgtggggagctcgcttaag
ttttgtatgttggcagaaggcagtgccgatctgtaccccagacttggcccaactagcgaa
tgggatactgctgcggcgcaagctgtgctcgaaagtgctggcggcacagttgtctgttac
gactcaggtgaaccattaacttataatcaaaaacctgacattttaaacccttactttatt
gccacagccccaggctgggtgaaataa

DBGET integrated database retrieval system