KEGG   Shewanella baltica OS195: Sbal195_1514Help
Entry
Sbal195_1514      CDS       T00622                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbn  Shewanella baltica OS195
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sbal195_1514
   00052 Galactose metabolism
    Sbal195_1514
   00500 Starch and sucrose metabolism
    Sbal195_1514
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal195_1514
Enzymes [BR:sbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sbal195_1514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1825264..1826172)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTIISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLRRDNLAAMVALFDETQVGQIMVEGVPHNVVNQYGI
ADVNGHDLQPGESEPLVELVEKPAVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAQYLKTVVKG
MK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcccgtcgcaggcttaggcactcgtatg
cttccagcgaccaaagcgattccaaaggaaatgctaccagttgtcgataagccattgatc
caatacgtggtcagtgaagctatcgctgctgggatcaaagaaattgtcctagtgacccac
gccagtaaaaactctatcgaaaaccacttcgataccagtttcgaattagaagcccaactc
gagcgccgcgttaaacgtcagttactcgaagccgtacaatctatttgccctaaagacgtc
actatcatcagcgtgcgtcaatctcaggcgaaaggattaggccacgccattttgtgcgca
aaatcagtcgtcggcgatgcaccatttgcagtattgctgccggatgtgatcatcgatgaa
gccagctgtgatctgcgtcgcgataacttagccgctatggttgcgctgtttgatgaaacc
caagtgggtcaaatcatggttgaaggcgtgccgcacaacgtcgtcaatcagtacggtatt
gctgatgtgaatggccatgatttacaacctggtgaatctgagccattagttgaattggtt
gagaaaccagccgtggatgaagcgccgtctaacttagccgttgtaggccgttatgtatta
cctgccagcatttggccactactggctaaaacccctgcaggcgcgggcgatgaaattcaa
ttaacagatgcaattgctatgttaatgaagcaagaaaccgtgaacgcttattatatggaa
ggtaagagccacgactgtggtaacaaacaaggttacatgcgtgcgaacgttgaatacgcc
ctgcgccacagcgaaatcggtgaagattttgcgcaatatttaaaaaccgttgtaaaaggg
atgaagtaa

DBGET integrated database retrieval system