KEGG   Shewanella baltica OS195: Sbal195_1535Help
Entry
Sbal195_1535      CDS       T00622                                 

Definition
copper-translocating P-type ATPase
Orthology
K17686  
Cu+-exporting ATPase [EC:3.6.3.54]
Organism
sbn  Shewanella baltica OS195
Brite
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Acting on acid anhydrides to catalyse transmembrane movement of substances
    3.6.3.54  Cu+-exporting ATPase
     Sbal195_1535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1847988..1850222
Genome map
AA seq 744 aa AA seqDB search
MSMTRLYVANMNCAGCVAKIEKAFGAQAGVEARVNLADKQVTVEGKMSADTALTVMEKAG
YPAQVVVDAKVAAEEKRLEDATEYRLRMRQAIAALVVGVPMMLWGLLGGEMMINSPAMQL
GWGIMGLVTLALLVTTGGHFYQGMWRALKAKTTNMDTLIVLGTSTAWAYSMLVVIMPSAF
PMDTRHVYFEASVMILGLINLGHGLELKARGKTSEAVQRLLGLQSTTAIRITDKGDEKVE
ISHLKLGDKLRLRPGDRVALDGEVETGQSLLDEAMLTGEPIPVLKNRGDSLSAGTVNGNG
SLVYRVTAGQEDTKLAKIIALVQQAQTSKLPIGRLADRISAVFVPTVVAIALLAAAIWYF
VGPAPALSHALVVLTSVLIIACPCALGLATPMSIMVAVGRAAQMGVLVKNGEALQTASKV
DCVVLDKTGTVTLGKPQVTDFNLVQTLSDADKETLLGEIASLEQHSEHPLAGAIVNYAKE
SLSQLPDTQAFTNHQGKGIEGKVDGVSLAIGNLALMTALDIVNSDGSALDPKATLSFANQ
GKTPIYIAKAGKLVATIALADPIKPDAKDAIAAMLQRGIRVVLLTGDNPQTAQAVADQVA
ITEVIAGVLPEQKQQHVLDLQKQGHVVAMVGDGINDAPALMSADVGIAMGSGTEVAIESA
DITLLSQQLIVIANLLVLSRATITNIKQNLFGAFVYNSLGIPVAAGVLYPLTGMLLSPVI
AGAAMALSSLTVVTNANRLRRQKL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaccagactctatgtcgccaatatgaattgcgctggctgcgtcgcgaaaatt
gaaaaggcgtttggcgcccaagcgggcgtcgaggcgcgtgttaatctcgccgataaacaa
gtgacggtagaaggtaagatgagcgccgatactgccttaactgtgatggaaaaagcaggt
tatccggcgcaggtggtggtggatgcaaaagtcgccgccgaagaaaaacgccttgaagat
gccactgagtatcggctgcggatgcgccaagccatagcggcgctggttgtgggcgtgcct
atgatgctgtggggattattgggcggcgagatgatgatcaacagtccagcgatgcagctt
ggctggggcattatgggactggtcaccttggccttgcttgtcaccacgggcggacatttc
taccaaggcatgtggcgggcgctaaaagccaaaaccactaacatggatacgctgattgtg
ctgggcaccagtacggcatgggcttattccatgctggtggtcattatgccgagcgcattc
cctatggatacccgccatgtctactttgaggcaagtgtgatgattctaggtttgattaac
ttaggtcacggactcgagcttaaagcgcgcggcaaaaccagtgaagcggtgcaacgatta
cttggcttgcaatccaccactgcgattcggatcacagataaaggcgatgaaaaggttgag
ataagtcatttgaaactgggcgataagctgcgtttgcgccccggtgaccgagttgccctc
gatggtgaggtcgaaacagggcaatccctactcgatgaagccatgctcactggtgagcct
attcctgtgcttaaaaatcggggagatagtctgagcgcgggcacagtcaatggcaacggc
agcttagtttaccgagtgacggctgggcaagaagataccaaactcgccaaaatcattgca
ctggtgcaacaggcacaaacgtcaaaattgcccataggtcgattggctgacagaatctca
gcggtatttgtcccgactgtggtggcgatagcgctgttggcagcggcaatttggtatttt
gtggggccggcacccgccttaagccatgcgttagtggtgctgacgagtgtgcttatcata
gcgtgtccctgtgcgctggggctggcgacacctatgtctatcatggttgctgttggccgc
gccgcccaaatgggcgtgttagttaaaaatggcgaggccttgcaaaccgccagtaaagtc
gattgtgtggtactggataaaaccggcactgtcaccttaggcaagccgcaagtcactgat
tttaatttagtgcaaacgctgagtgatgccgacaaagaaaccttgctgggcgagattgcg
agccttgagcagcactctgagcatccgttagcgggggcgattgtcaattatgccaaggaa
tccctgtcgcaattacccgacacacaggcatttacgaaccatcaaggtaaggggattgag
ggcaaggtcgatggcgtatcgctggcgattggtaatctcgccttgatgacagctttggat
attgtcaattccgatggcagcgccttagacccaaaagcgacattaagctttgcaaaccaa
ggtaaaactccgatttatatcgccaaagcgggcaagttagtggccactatagcgcttgcc
gatccgattaaacccgatgctaaagacgccatcgcggccatgctgcaaagggggattcgc
gtggtgctgttaacgggggataacccacaaacggcgcaggcggtggccgaccaagtggcc
atcaccgaagtgattgccggggtactccccgagcagaaacaacagcatgtgctggatttg
caaaagcaaggacatgtggtggctatggtaggggatggcattaacgatgcgcctgctctg
atgagcgccgatgtggggatcgcgatgggttcgggcactgaggtggcgattgaaagtgcg
gatatcaccttactgtcgcagcagttgatagtgattgctaacttattggtattgtcgcgg
gcgacaattaccaatattaagcagaatctgtttggcgcctttgtgtataacagcttaggc
attccggttgcggctggcgtgctttatccactcacgggcatgttattaagccctgtgatc
gcgggtgccgccatggccttgtcttcactcacggtcgtcacgaacgccaaccgcttaaga
cggcagaagttataa

DBGET integrated database retrieval system