KEGG   Shewanella baltica OS195: Sbal195_1879Help
Entry
Sbal195_1879      CDS       T00622                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbn  Shewanella baltica OS195
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2247382..2248407)
Genome map
AA seq 341 aa AA seqDB search
MSLELLQAAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNPELNQRLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTELSQSLKDTNLDANEFQSRIESNFEKL
NRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCFNRRAFDSDFAGMLAQAPLGTCVILADIDHFKVFNDTYGHQLGDQVLRAVAKR
LQESCRDGAKLYRFGGEEFVIIVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERINNIS
ASFGVAQWQEKQTGMQLIEAADKLLYDAKRLGRNRVLPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctagagttattacaagccgctgcactgaatctcaaaaaagcagtgcctctgatg
ctcaaacataaaattccgaccaccccggttaactatgcgctttggtacacttatgttggt
gaacagaatcccgaattaaatcaacgactcgataccgttatcgcccagtacaacacttgt
cctcctgtgagtagcgaactcttatatcgccagtatgttgccgatcccgttgaactcgat
gtccgcgaaatgcgccagaatctggatgctatggtgactgagctgtcccaatcgctcaaa
gataccaatctagatgccaatgaattccagtcgcgcatcgagagtaattttgaaaagctc
aaccgcatcgaagatgagggttttagtgttgagcaagtgctcgatctggtgcgcagttta
gtgaaagagtcggacaatattcgctcgagcactgagttctttaccggacaattgcagaaa
gcgcaaaccgaaatcgatgcgctaaagaaaaagctcgaacagacagaaaaagatgtgctc
tacgatgcgctgactggctgctttaatcgccgcgccttcgacagcgattttgctggcatg
ttagcccaagcgcccttaggcacctgcgtgatcttggccgatatcgaccattttaaagtg
tttaacgacacctacggccaccagctcggcgaccaagtgttacgcgccgtggcaaaacgg
ctacaggaatcctgccgcgatggcgcaaaactgtatcgttttggcggtgaagaatttgtg
attattgtgcctaaaagtcagttacgcatcgcaaggcaactggccgaagccatgcgccgt
ggactcgaaaagctcagtttgaaagacagacgtaaagacgagcgcatcaataatatcagt
gcctcatttggggttgcccaatggcaagaaaaacaaacgggcatgcagttgattgaagcg
gcagataaattactctatgacgcgaaacgtttaggtcgaaatcgcgtgttgccgatcagc
aactga

DBGET integrated database retrieval system