KEGG   Shewanella baltica OS195: Sbal195_1879Help
Entry
Sbal195_1879      CDS       T00622                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
sbn  Shewanella baltica OS195
Brite
Enzymes [BR:sbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     Sbal195_1879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2247382..2248407)
Genome map
AA seq 341 aa AA seqDB search
MSLELLQAAALNLKKAVPLMLKHKIPTTPVNYALWYTYVGEQNPELNQRLDTVIAQYNTC
PPVSSELLYRQYVADPVELDVREMRQNLDAMVTELSQSLKDTNLDANEFQSRIESNFEKL
NRIEDEGFSVEQVLDLVRSLVKESDNIRSSTEFFTGQLQKAQTEIDALKKKLEQTEKDVL
YDALTGCFNRRAFDSDFAGMLAQAPLGTCVILADIDHFKVFNDTYGHQLGDQVLRAVAKR
LQESCRDGAKLYRFGGEEFVIIVPKSQLRIARQLAEAMRRGLEKLSLKDRRKDERINNIS
ASFGVAQWQEKQTGMQLIEAADKLLYDAKRLGRNRVLPISN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctagagttattacaagccgctgcactgaatctcaaaaaagcagtgcctctgatg
ctcaaacataaaattccgaccaccccggttaactatgcgctttggtacacttatgttggt
gaacagaatcccgaattaaatcaacgactcgataccgttatcgcccagtacaacacttgt
cctcctgtgagtagcgaactcttatatcgccagtatgttgccgatcccgttgaactcgat
gtccgcgaaatgcgccagaatctggatgctatggtgactgagctgtcccaatcgctcaaa
gataccaatctagatgccaatgaattccagtcgcgcatcgagagtaattttgaaaagctc
aaccgcatcgaagatgagggttttagtgttgagcaagtgctcgatctggtgcgcagttta
gtgaaagagtcggacaatattcgctcgagcactgagttctttaccggacaattgcagaaa
gcgcaaaccgaaatcgatgcgctaaagaaaaagctcgaacagacagaaaaagatgtgctc
tacgatgcgctgactggctgctttaatcgccgcgccttcgacagcgattttgctggcatg
ttagcccaagcgcccttaggcacctgcgtgatcttggccgatatcgaccattttaaagtg
tttaacgacacctacggccaccagctcggcgaccaagtgttacgcgccgtggcaaaacgg
ctacaggaatcctgccgcgatggcgcaaaactgtatcgttttggcggtgaagaatttgtg
attattgtgcctaaaagtcagttacgcatcgcaaggcaactggccgaagccatgcgccgt
ggactcgaaaagctcagtttgaaagacagacgtaaagacgagcgcatcaataatatcagt
gcctcatttggggttgcccaatggcaagaaaaacaaacgggcatgcagttgattgaagcg
gcagataaattactctatgacgcgaaacgtttaggtcgaaatcgcgtgttgccgatcagc
aactga

DBGET integrated database retrieval system