KEGG   Shewanella baltica OS195: Sbal195_1892Help
Entry
Sbal195_1892      CDS       T00622                                 

Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
sbn  Shewanella baltica OS195
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2261319..2262302)
Genome map
AA seq 327 aa AA seqDB search
MLNTPPLRRLRRLRSSEAMRDLLRETHISLSDLIHPLFIEEHITHAVPISTLPGISRLPE
TALAEEVRELYALGIRYVMPFGISHTKDDKGSDTWDDNGLLARMVRTIKAAVPEMMVIPD
ICFCEYTDHGHCGVVHNNEVCNDLTVENLVKQSVTAAKAGADMLAPSAMMDGQVKAIRQG
LDAAGFEHVAILAHSAKFASSFYGPFRAAVDCELSGNRKGYQLDYANGRQALLEASLDEA
EGADILMVKPGTPYLDVLSRLRQETHLPLAAYQVGGEYAGIKFAALAGALDERAVVTETF
VGLKRAGADLIVSYYTKQYAQWLAESR
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacacgcctccattgcgtcgcctaagacgcttacgtagttcagaagcgatgcgc
gatctgttgcgcgaaacccatatttcgttaagcgatctcatccatcccctgttcatagaa
gaacacatcacccacgcagtgcctatctccacgttacctggcatcagccgcttacctgag
actgcactggctgaagaagtgcgcgagctttacgccctcgggatccgttatgttatgccc
tttgggatttcgcacactaaggatgataaaggcagcgacacatgggatgacaatggcttg
ctcgcccgcatggtgcgcaccattaaagccgccgtgccagagatgatggtgatccccgac
atttgtttttgtgaatatacagatcacggccattgcggcgtggtgcacaataatgaagtc
tgcaacgatctcaccgtcgaaaatttagttaagcaatctgtgactgccgccaaagcgggc
gccgatatgttagcgccatcggccatgatggacggtcaagtgaaagccattcgccaaggg
ctcgatgccgcaggttttgagcatgtggcgattctggcccactcggcaaaattcgcctct
tccttctacggtccttttagagcggcggtcgattgtgaactcagtggtaaccgcaaggga
tatcagcttgattatgccaacggtcgccaagccctgttagaagcctcattagatgaagcc
gaaggcgccgatatcctgatggttaaacccggtacgccctacttagatgtgttaagccgt
ttaagacaagaaacccacctgccactcgccgcctatcaagtcggcggcgaatatgcaggc
atcaagtttgccgcccttgcaggcgcgttggatgagcgtgctgtggtgacagaaacgttt
gtcggcttaaagcgagccggagcggatttgattgtcagctattacaccaaacagtacgcc
cagtggttagccgagagtagatag

DBGET integrated database retrieval system