KEGG   Shewanella baltica OS195: Sbal195_1955Help
Entry
Sbal195_1955      CDS       T00622                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
sbn  Shewanella baltica OS195
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Sbal195_1955
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal195_1955
   00620 Pyruvate metabolism
    Sbal195_1955
   00650 Butanoate metabolism
    Sbal195_1955
  Lipid metabolism
   00071 Fatty acid degradation
    Sbal195_1955
  Amino acid metabolism
   00350 Tyrosine metabolism
    Sbal195_1955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Sbal195_1955
   00626 Naphthalene degradation
    Sbal195_1955
Enzymes [BR:sbn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Sbal195_1955
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Sbal195_1955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2337011..2339614)
Genome map
AA seq 867 aa AA seqDB search
MTVTNAQELDLMVERVAKAQAEYATFSQAQVDKIFRAAALAAADARISLAKMAAAETRMG
VVEDKVIKNHFASEYIYNKYKDEKTCGILSEDVTFGTITIAEPVGIICGIVPTTNPTSTA
IFKALISLKTRNAIIFSPHPRAKVSTTTAAKLVLDAAIAAGAPKDIIGWIDEPSVALSNQ
LMTHPRINLILATGGPGMVKAAYSSGKPAIGVGAGNTPIVIDETADIKRAVSSILMSKTF
DNGVVCASEQAVIVVDSIYEQVKERFISHGGYMLSKNETAAMQQVILKNGGLNADIVGQS
AASIAQMAGFEVPHWTKVLIGEVTDICDSEAFAHEKLSPLLGMYRAIDFNDAMDKAEALV
ALGGIGHTSGLYTDQDTQTERVHAFGFRMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPSHLINKKTVAKRAENMLWHKLPASIYFRRGSLPIALEELSDKKRA
LIITDRFLFNHGYCDETMRILKAQGLETEIFYDVEADPTLAIVRQGAKVAQSFKPDVIIA
LGGGSPMDAAKIIWVMYEHPDVDFADLALRFMDIRKRIYKFPKMGTKAMMVAIPTTSGTG
SEVTPFAVVTDEITGKKYPIADYQLTPNMAIVDPNLVMDMPKSLTAFGGIDAVTHALEAY
VSVMANEYSDGQALQALDLLCKYLPDAYNLGSQSPVAREKVHNGATIAGIAFANAFLGIC
HSMAHKLGAEFHLAHGLANALLINNVIRFNATDLPTKQAAFSQYDRPKALCRYAAIADHL
KLGGKTDEEKVEKLLEKITHLKKTIGIPASIQEAGVNEADFLAKLDELAEDAFDDQCTGA
NPRYPLINELKQLFLDSYYGRDYSDNN
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgaccaatgcacaagaactggatctcatggtcgagcgtgttgcgaaagcacaa
gccgaatatgcgacattcagccaagcgcaagtcgataaaattttccgcgcagcggccctt
gccgctgccgatgcgcgtatctcgctggcaaaaatggccgccgcagaaacccgcatgggt
gtcgttgaagacaaagtgatcaaaaaccactttgcctctgagtatatttataacaaatac
aaagatgaaaaaacctgcgggattttatctgaagacgtcaccttcggcactatcaccatt
gccgaacctgtgggcatcatttgtggcatagtaccgaccacgaaccccacatcgaccgcg
atatttaaggccttaatcagccttaaaacccgtaacgcaattatcttctcgccccaccca
agggccaaagtttccaccacaactgcggcaaaattagtgcttgatgcagccattgctgct
ggcgcgcccaaagacattattggctggattgatgaacccagcgtcgcactgtcaaatcaa
ttgatgacacacccaaggatcaatttaattctcgcaacaggtggcccaggcatggtgaaa
gccgcctactcttccggtaaacccgcgattggcgtaggtgcgggtaacacgcctattgtt
atcgatgaaaccgccgacatcaaacgcgcggtcagttcgattctcatgtcgaaaaccttc
gataacggcgtcgtttgtgcgtcagaacaagctgtgattgtggttgacagtatttatgag
caagtaaaagagcgctttatctcccacggtggctacatgctatcgaagaatgaaaccgcg
gcgatgcaacaggtcattttaaaaaatggcggtttgaatgccgatatcgttggccaaagc
gccgccagtatcgcgcaaatggcgggctttgaagtgccgcactggactaaggttctgatt
ggtgaggtcaccgacatttgcgacagcgaagccttcgcccatgaaaaattatcgccactg
cttggcatgtaccgcgccatcgactttaacgatgccatggataaagccgaagctttagtc
gcacttggcggcattggtcacacttcagggctttataccgaccaagatacccaaactgaa
cgtgtgcatgcctttggttttagaatgaaaacagcacgtatcttgatcaacactcctgcc
tcacagggtggtattggcgatctgtacaacttcaaactagcaccttcactcactttgggt
tgtggttcttggggcggcaactcgatttcagaaaacgttggcccaagtcatctgatcaac
aaaaaaaccgtcgctaagagggccgaaaacatgttgtggcataaacttcctgcatccatc
tatttccgccgcggcagtttacccatcgcgctcgaagaactgagcgataaaaaacgcgcc
ttaatcatcacagacagatttttgttcaatcacggttattgcgacgaaactatgcggatt
ttaaaggcccaaggccttgaaaccgaaatcttttacgatgttgaagccgacccaacctta
gccatagtccgtcaaggcgctaaggtggcccaaagctttaaacccgatgtaattattgca
ctcggcggcggctcaccaatggatgcggctaagattatttgggtgatgtacgagcatccc
gatgtggattttgccgatttggcgctgcgctttatggacattcgtaaacgtatctacaaa
ttccctaaaatgggcaccaaggccatgatggtggctattccaaccacttcaggcacaggc
tcagaagtcaccccttttgcggtagtgacagacgaaattaccggtaaaaaatacccgatt
gccgattatcaactcacgcccaacatggcgattgttgatcctaatctagtgatggacatg
cctaaatctctgaccgcctttggtggcatagatgcggtgacccatgctcttgaagcctat
gtcagcgtgatggcgaacgaatacagcgacggccaagcactgcaagccctcgacttactg
tgcaaatatttacccgatgcgtacaacttgggctcacagtcacccgtcgcccgtgaaaaa
gtccacaatggcgccaccatcgcaggtatcgcctttgctaacgctttcctcgggatttgc
cactcaatggcgcacaaactgggcgcagaattccatctcgcccacggtttagccaatgcg
ctgctgatcaataacgtaatacgctttaacgcaacagatctgcccactaagcaagcggcc
tttagccaatacgacaggccaaaagccctgtgccgttatgctgccatcgcagatcacttg
aaactaggcggaaaaacggatgaagaaaaagtcgaaaaattgcttgagaaaatcacacac
ctcaagaagacgattggcattcctgcttctatccaagaagccggcgtcaacgaagccgac
ttcctcgccaagttagatgaattagccgaagatgcgttcgatgatcaatgtaccggtgcc
aacccacgttaccccttgattaacgagctgaaacaactgttcctcgatagctattatggc
cgtgactatagcgacaacaactag

DBGET integrated database retrieval system