KEGG   Shewanella baltica OS195: Sbal195_2129Help
Entry
Sbal195_2129      CDS       T00622                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sbn  Shewanella baltica OS195
Brite
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Sbal195_2129
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2536747..2537313
Genome map
AA seq 188 aa AA seqDB search
MNSKLKAILLAAGLSSAAITGAQLTDKWEGNSLSVYVDAVGVLTACRGHTSKDLKLDQIF
TEQQCMEIFAKDIARADKQLLQLTAPVALTDGEHAAYLSFMHWAGYGNFASSTLRKKLLV
GDRVGACKELTQACSTNPQTGERICNGWTYGTRLGAKVRLNGLIKRRAEEQTICLSELGL
SQSKGGAQ
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaacagtaaactcaaggcgattttactggccgctggcttaagttcggcggctatcact
ggcgcacagcttaccgataaatgggaaggcaatagcctgagcgtctatgtcgatgcggtg
ggtgtactgaccgcctgccgtggccatacgagcaaagacttaaagcttgatcaaatcttc
accgaacagcaatgcatggagatttttgccaaggatatcgctcgcgctgataagcagttg
ctgcaactcacggcccctgtagcacttactgatggcgagcatgcggcctatctgtcgttt
atgcattgggcgggctatggcaattttgccagctcaaccctgcgtaaaaagctgcttgta
ggggatcgtgtgggcgcctgcaaggagctaacgcaggcctgttccaccaatcctcaaacg
ggtgagcgcatctgcaatggttggacctatggcacccgcctaggtgccaaggtgcgccta
aatgggctgattaaacgccgcgccgaagagcagaccatttgcttaagcgaactgggcctc
tcgcaatcaaaggggggcgcgcaatga

DBGET integrated database retrieval system