KEGG   Shewanella baltica OS195: Sbal195_2186Help
Entry
Sbal195_2186      CDS       T00622                                 

Definition
(GenBank) aminotransferase class I and II
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sbn  Shewanella baltica OS195
Pathway
sbn00220  Arginine biosynthesis
sbn00250  Alanine, aspartate and glutamate metabolism
sbn00290  Valine, leucine and isoleucine biosynthesis
sbn01100  Metabolic pathways
sbn01110  Biosynthesis of secondary metabolites
sbn01130  Biosynthesis of antibiotics
sbn01210  2-Oxocarboxylic acid metabolism
sbn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Sbal195_2186
   00290 Valine, leucine and isoleucine biosynthesis
    Sbal195_2186
   00220 Arginine biosynthesis
    Sbal195_2186
Enzymes [BR:sbn01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Sbal195_2186
    2.6.1.66  valine---pyruvate transaminase
     Sbal195_2186
Amino acid related enzymes [BR:sbn01007]
 Aminotransferase (transaminase)
  Class I
   Sbal195_2186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: ABX49355
UniProt: A9L1B0
Position
complement(2598079..2599293)
Genome map
AA seq 404 aa AA seqDB search
MRPIIKSNKLDSVCYDIRGPVHKEARRLEDEGHRILKLNIGNPAPFGFEAPEEIVRDVIL
NLPSAQGYCESKGLFSARKAIVQHYQAQGIFGVDIEDIYIGNGVSELIMMAMQGLLNTDD
EILIPSPDYPLWTAAANLAGGKAVHYRCDEEADWFPDLNDIKSKISSRTRGIVLINPNNP
TGAVYSKELLLQVVELCREHSLILFADEIYDKILYDEAKHVPAAGLSDDILTVTFNGLSK
AYRAAGFRVGWMMLSGNLKAAKSYIEGLEMLSSMRLCANVPNQHAIQTALGGYQSINELI
LPNGRLTVQRDACYELLNQIPGVSVKKPKGALYAFPKLDMKKFNLRDDERLVLDLLREKK
ILLVHGTAFNWPEPDHLRVVFLPYKEDLKKAFTEFGAFLENYRQ
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcgccctatcatcaaatccaacaagctggatagcgtttgctatgacatccgcggccca
gtgcacaaggaagccagacgtttagaagacgagggtcatcgaatcctcaaacttaacatt
ggtaatccggctcccttcggtttcgaagcgccggaggaaattgtgcgcgatgtgatcctt
aatctacccagtgcccaaggctactgtgagtcaaaaggattattctctgcccgcaaggcc
atagtgcagcattatcaagcccaagggatttttggtgtcgatatcgaagatatctatata
ggcaacggcgtctctgaactcataatgatggcaatgcaaggtttgcttaacacggatgat
gaaattttaatcccctcgcctgactatccactgtggacggcggcggccaatctcgccggc
ggcaaagccgtgcattatcgttgcgatgaagaagcggactggttccccgatctcaacgac
attaaaagcaaaatttcatcgcgtacccgcggtattgtgctgatcaacccgaacaatcct
acgggcgcggtttacagcaaagaattactgctgcaagtggttgagctttgccgtgaacac
agtttgattttatttgccgatgaaatttacgacaaaattttgtatgacgaagccaagcat
gttcctgcggctggcctgtcggacgatattttaactgttaccttcaatggtctatcaaag
gcttatcgcgcagcgggatttcgcgtcggttggatgatgttgtctggcaatcttaaagcc
gcgaagagctatatcgaaggtttagagatgctctcttcgatgcgcctgtgtgcaaacgtg
cccaatcaacatgcgattcaaaccgcgctcggcggctatcaaagtattaacgagctaatt
ttacctaatggccgtttgaccgttcaacgggatgcctgttacgagctgttgaatcaaatc
ccgggcgtcagcgtgaaaaagcctaagggcgcactgtatgctttccctaaactggatatg
aaaaaattcaatctgcgggatgatgagcgcttagtgctggatttactcagagaaaagaaa
attctgttagtgcacggcaccgcctttaattggcctgagcccgaccatttacgagtggtt
ttcttaccctataaagaagatctgaaaaaagcatttaccgagtttggcgccttcctcgaa
aactatcggcagtag

DBGET integrated database retrieval system