KEGG   Shewanella baltica OS195: Sbal195_2370Help
Entry
Sbal195_2370      CDS       T00622                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbn  Shewanella baltica OS195
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2794875..2795903)
Genome map
AA seq 342 aa AA seqDB search
MPSTAENKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAGTNLDLNRAIDGFLAN
SVSFTKEVNTSLYKNFIQEQSPEVIENVQIETQILINSLLSKISQLSQGTAAFSGSLAEF
GLRLQTNPDINTLNELVDGVVDEMQMLLINNREMEQSLCTMGQEVQNLKSEMENLSLAAM
TDQLTSLHNRRAYELSIQDQIYLSQDHQTRCSLLLIDIDNFKAFNDTYGHLTGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVVLPNTHFHDALQVAENLRERISERRLTIGKDKKLSL
GAITVSIGLASLQQGDDAETLFSRADKALYQAKAEGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgccttctactgcagaaaataaagagcttgattctgccgcgcaaattttgcgtttggcc
gtaccgcaaatgtctgccctcgatatccccgttacacctgaaaactacactgtttggtat
gaatattttgcagggacaaatctcgatttaaatcgtgcgattgatggctttctggctaat
tcggtctcttttactaaggaggtcaataccagcctgtataagaacttcattcaagaacag
tcacccgaagtgattgaaaatgtgcagattgaaacgcaaatcctgatcaatagtttgtta
agtaaaatcagccagttgagtcaaggtaccgcggcgttttcaggttcattagccgagttt
ggtctacgtctacagacgaatcccgacattaataccttaaacgagctggttgatggtgta
gtcgatgaaatgcagatgctgctcatcaacaaccgtgagatggagcaaagcctgtgcacc
atgggccaagaagtgcaaaatcttaaatcggaaatggaaaacctgagcctggcagcgatg
actgaccaattaacctcgctgcacaatcgccgtgcctatgagttaagtattcaagatcaa
atctacctctcccaagatcaccaaacccgttgcagtcttttactgatcgatattgataat
tttaaagcctttaacgacacctatggtcatttgaccggcgataaagtgttggcctatgtc
gcattagccttgaaacaatgtgtgcgaggggatgattttgtggcgcgctatggcggcgaa
gaatttgtggtggtgttacctaacactcattttcacgatgcattacaagtggctgagaat
ttgcgggaacgtatctctgagcgccgcttaaccatagggaaagacaaaaagctttccctt
ggcgcgattactgtttctattggtctggcttcattgcagcaaggcgacgatgcagaaact
ctattcagtcgcgccgacaaagcgctgtatcaagctaaggccgaaggtcgtaactgcgtg
agaggataa

  All links  
No link information was found.   
DBGET integrated database retrieval system