KEGG   Shewanella baltica OS195: Sbal195_2453Help
Entry
Sbal195_2453      CDS       T00622                                 

Definition
glucan 1,4-alpha-glucosidase
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sbn  Shewanella baltica OS195
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal195_2453
Enzymes [BR:sbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Sbal195_2453
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2900984..2903560
Genome map
AA seq 858 aa AA seqDB search
MESSPTPQQDLHTSQTRHAQTLTRRSRLALAVAASLLGTIGFTACSPTSNSATPSMSGNA
ASNVQLVAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDAKQNPISRVWFSLAQGILTE
TMYGLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINKDIEG
KYQIEKHIFTDPDRDTLMMRVTFTAFEDGITPHLYVNPHIDNAGANDIGRIDTNTDNHTN
THAGNQALVAYTAAKDSSVMTVKSELNFVQATTGFVGVSDGLADLADNGKLDTPYQTTST
QDKSTVGNIAFTASYPTLIKAKPVTFNLVIGFGKDGAQSLANADATLAAGYDAVLSAYKG
DATHVGWHDYLSSLPAIANMANNTTDSGKLLYTSAMVLKAQEDKTYAGALIASLSNPWGD
TVSAAVPSTGYKAVWPRDFYQCAMAFLAMGDTQTPKVAFEYLKKVQVTEMTPGFTGTPGW
FLQKTHVDGQIEWVGVQLDQTAMPIMLGWKLWQAGVLTPDEISHWYQEMLKGAADFLISG
GEVNLDWNHTQIAPPKTQQERWEEQAGYSPSTTAAVIAGLVAASEIAKEAKDPDSSSRYL
AAAKDLSNSLEKHLVTTQGLLKNSAGVSAPYYLRLSPNGEPNTSDRLAANNGKQGLDQRQ
ILDGGFLELVRYGVRGATDKLINQSLQLIDNTELDSNLRLKYEFTAKDGSKIPGFRRYGN
DGYGEDTVSGKNYAESGSNSADQRGRVWPFFTGERGHFELALAQEKGELTGNNSQQTKQQ
LINTYVQGMETFANAGMMLPEQAWDGVGDATRYHYQLGQGTNSATPLAWTHAEYIKLVRS
MTDGQVWDNYPIVPAALK
NT seq 2577 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagtcctacgccgcagcaggatctgcacactagccaaacccgtcacgcacaa
acgttaacaaggcgcagccgcctagcgcttgccgtcgccgcaagtctattagggacaata
ggattcactgcttgttcacccacatcgaattcagcaacaccaagcatgagtggcaatgcc
gcatcaaatgtgcagctggttgcgcccggcgcaccgggtaaagcaccgacttgggcattt
tcgggtaaaaccggtattggaacgtcgtacgagccttacacccaaggtcaataccaagat
gccaagcagaatcctattagccgcgtttggttctccctcgcccaaggtattttaaccgaa
accatgtatggtcttattcacaatgcgcagctcaaagaactgcaatttgtgatcacggga
aatggctttgtcgatacagaaaaagataacaccatcagcagcatagaatatttagatacc
gatgctaatggtcgcccacaatcccttgcctataaaattatcaataaagatattgaaggt
aagtatcagattgaaaagcatatctttaccgatcctgaccgcgacaccctaatgatgcgc
gtcacctttaccgcctttgaagacggcattacgccgcatttgtatgtcaatccgcatatc
gataacgcgggcgccaatgatatcggccgcatcgacactaatacagacaatcataccaac
acacatgctggcaatcaggcgctggtggcctataccgccgccaaagacagcagcgtgatg
acggtcaaatccgagctgaattttgtgcaggcaacgacaggctttgtcggtgtctccgat
ggtctagccgatttggccgataacggcaaactcgatacaccctatcaaacgaccagtacg
caagataaatcgaccgttggcaatatagcttttactgcgagttaccctacgctcatcaaa
gccaaacccgtcacttttaatctcgtcatcggttttggtaaagatggagcacagagttta
gccaatgccgatgccactttggccgcaggttatgatgctgtgctgagcgcctataaaggc
gatgccacccatgtcggctggcacgattacttaagctcgctgcccgccatcgcaaacatg
gccaacaacaccacagatagcggtaagctgctgtataccagtgctatggtcttgaaagcg
caggaagataaaacctatgcgggagcacttatcgcctcgttatccaatccttggggcgat
acggtttcagcagccgtgccgagtactggctataaagcggtatggccgcgtgacttttac
caatgtgccatggcattcctcgccatgggtgacacccaaacgcccaaagtggccttcgaa
tacctgaaaaaagtgcaagtgaccgaaatgacgcccggctttacgggtacgccgggttgg
ttcctgcaaaagacccatgtggatggccaaattgagtgggttggtgtgcagctcgatcaa
accgccatgcctatcatgctcggctggaaactctggcaagcgggtgtgctcacccctgat
gagatcagtcactggtatcaagagatgctcaaaggtgctgcagacttcttgatcagtggc
ggtgaggtcaatctggattggaatcacactcaaatcgccccgccaaaaacccagcaagag
cgttgggaagaacaagcgggttactcaccctcgaccacggccgcagtgatcgcaggtctt
gttgccgcgagtgaaatagccaaagaagccaaggatcccgactccagcagccgttatctt
gcagccgccaaagacttaagtaatagtttagaaaaacacttagtcaccacccaaggacta
ctaaaaaacagcgcaggcgtcagcgcgccttactatttacgtttaagcccaaatggcgag
ccaaacaccagcgatagactggcggcaaataacggtaagcaaggtttagatcaacgtcag
atcctcgatggcggatttttagaactagtacgttatggcgtgcgcggtgcaactgataag
ctcatcaatcaaagccttcaattgattgataacactgaacttgactctaatttgcgcctt
aaatatgagtttactgccaaagatggcagcaaaatcccaggctttagacgttatggcaac
gatggctacggtgaggatacggtttctggcaagaactatgcggaatcgggcagcaacagc
gccgatcaacgtggccgcgtctggcccttcttcaccggtgagcgcggtcattttgaatta
gcactcgcccaagaaaaaggcgagctaacaggcaataactcgcagcaaaccaagcagcag
ttgatcaacacctatgtgcaaggcatggaaacgtttgcgaatgcgggcatgatgttaccc
gagcaagcgtgggacggtgtcggcgatgccacccgctaccattaccaactcggacaaggc
actaactcagccacgccgctagcctggacccatgccgaatacattaaactggtgcgctca
atgaccgacggccaagtctgggataactaccctatcgtcccagcggcattgaaataa

DBGET integrated database retrieval system